DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap25 and SNAP33

DIOPT Version :9

Sequence 1:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001332102.1 Gene:SNAP33 / 836242 AraportID:AT5G61210 Length:300 Species:Arabidopsis thaliana


Alignment Length:213 Identity:58/213 - (27%)
Similarity:104/213 - (48%) Gaps:21/213 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VPKTELEELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEEGMDQINAD 77
            :....::||:..|...|:|:.:|.:..|.:.|:.:....||||.|.|||||:.|......:|:.|
plant    93 IENQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHDQGEQITRTHHKAVEIDHD 157

  Fly    78 MREAEK---NLSGM-------EKCCGICVLPCNKSQSFKEDDGTWKGNDDGK----VVNNQPQRV 128
            :...||   :|.||       :|     ..|.|.....::|..|.:.|...|    .:|:.|:..
plant   158 LSRGEKLLGSLGGMFSKTWKPKK-----TRPINGPVVTRDDSPTRRVNHLEKREKLGLNSAPRGQ 217

  Fly   129 MDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKG 193
            ...|..:...|....|:  :..:.:.::.:..::.::|.|:|||:|||||:|.||:.:|.::...
plant   218 SRTREPLPESADAYQRV--EMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNKGLDHLHDDV 280

  Fly   194 ESNEARIAVANQRAHQLL 211
            :....|:..:|||..:||
plant   281 DELNFRVQQSNQRGRRLL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 21/61 (34%)
SNAP-25 98..149 CDD:279208 11/54 (20%)
SNARE_SNAP25C 151..209 CDD:277238 18/57 (32%)
SNAP33NP_001332102.1 SNARE_SNAP25N_23N_29N_SEC9N 104..167 CDD:277214 21/62 (34%)
SNARE_Qc 238..296 CDD:277194 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2314
OMA 1 1.010 - - QHG60093
OrthoDB 1 1.010 - - D1197028at2759
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm952
orthoMCL 1 0.900 - - OOG6_102919
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.