DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap25 and Snap23

DIOPT Version :9

Sequence 1:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_038961739.1 Gene:Snap23 / 64630 RGDID:620221 Length:221 Species:Rattus norvegicus


Alignment Length:216 Identity:113/216 - (52%)
Similarity:145/216 - (67%) Gaps:26/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEEGMDQINADMREAEK 83
            ||:|:.|..|.|||||||||:|.|..||::|||:|:..||:|||||:||||||||||.|||||||
  Rat     7 EEIQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEK 71

  Fly    84 NLSGMEKCCGICVLPCNK--------------SQSFKEDDGTWKGNDD---GKVVNNQPQRVMDD 131
            .|:.:.||||:||.|||:              .:|.|....||....|   ..||:.||.|:   
  Rat    72 TLTELNKCCGLCVCPCNRFSVGGCFFETRTKNFESGKNYKATWGDGGDSSPSNVVSKQPSRI--- 133

  Fly   132 RNGM------MAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRIN 190
            .||.      .|..|||.||||||||||||||:.||.:::|||:|||||||:|::.||:||.:|.
  Rat   134 TNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKIT 198

  Fly   191 RKGESNEARIAVANQRAHQLL 211
            .|.::|:.||.:||.||.:|:
  Rat   199 EKADTNKNRIDIANTRAKKLI 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 43/58 (74%)
SNAP-25 98..149 CDD:279208 23/73 (32%)
SNARE_SNAP25C 151..209 CDD:277238 33/57 (58%)
Snap23XP_038961739.1 SNARE_SNAP23N 9..75 CDD:277248 45/65 (69%)
SNAP-25 100..157 CDD:395673 20/59 (34%)
SNARE_SNAP23C 159..217 CDD:277237 33/57 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8287
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60093
OrthoDB 1 1.010 - - D495812at33208
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm9089
orthoMCL 1 0.900 - - OOG6_102919
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1125
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.