DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap25 and snap25

DIOPT Version :9

Sequence 1:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001016501.1 Gene:snap25 / 549255 XenbaseID:XB-GENE-948769 Length:206 Species:Xenopus tropicalis


Alignment Length:197 Identity:119/197 - (60%)
Similarity:150/197 - (76%) Gaps:1/197 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KTELEELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEEGMDQINADMR 79
            :.||||:|..|..:||||||||||||...|.||:|||||||.||:|||||:||||||:|||.||:
 Frog     8 RNELEEMQRRADQLADESLESTRRMLQYVEGSKDAGIRTLVMLDEQGEQLERIEEGMEQINKDMK 72

  Fly    80 EAEKNLSGMEKCCGICVLPCNKSQSFKEDDGTWKGNDDGKVVNNQPQRVMDDRNGMMAQAGYIGR 144
            ||||||:.:.|.||:||.||||.:|.......|..|.|| ||.:||.||:|:|..|....|::.|
 Frog    73 EAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDG-VVASQPARVVDEREQMAISGGFVRR 136

  Fly   145 ITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQRAHQ 209
            :||||||.||:||:.||:.:|||||:||||||:|::.||||||||..|.:||:|||..||:.|.:
 Frog   137 VTNDARETEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKARIDEANKHATK 201

  Fly   210 LL 211
            :|
 Frog   202 ML 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 46/58 (79%)
SNAP-25 98..149 CDD:279208 22/50 (44%)
SNARE_SNAP25C 151..209 CDD:277238 36/57 (63%)
snap25NP_001016501.1 SNARE_SNAP25N 10..82 CDD:277247 52/71 (73%)
SNAP-25 91..141 CDD:366328 22/50 (44%)
SNARE_SNAP25C 143..201 CDD:277238 36/57 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11609
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3343
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1197028at2759
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm9503
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3593
SonicParanoid 1 1.000 - - X1125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.