DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap25 and Snap47

DIOPT Version :9

Sequence 1:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_955421.1 Gene:Snap47 / 303183 RGDID:735194 Length:419 Species:Rattus norvegicus


Alignment Length:88 Identity:23/88 - (26%)
Similarity:41/88 - (46%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSEEVAPQVPKTELEELQINAQGVADESLESTRR---MLALCEESKEAGIRTLVALDDQGEQLDR 66
            ||..|...:.:....||.::..|.|........|   ::.|...|:.....|...|..||||||.
  Rat    85 PSRNVVFNIIEHFWRELLLSQPGTAANPTSPMTRGQELMGLMASSQRRMEDTAKVLHHQGEQLDS 149

  Fly    67 IEEGMDQINADMREAEKNLSGME 89
            :..|::::.:|:..|::.|:.:|
  Rat   150 VMRGLEKMESDLDVADRLLTELE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 16/61 (26%)
SNAP-25 98..149 CDD:279208
SNARE_SNAP25C 151..209 CDD:277238
Snap47NP_955421.1 PH-like 12..98 CDD:302622 3/12 (25%)
SNARE_SNAP47N 106..170 CDD:277241 17/63 (27%)
SNARE_SNAP47C 359..417 CDD:277207
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.