DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap25 and aex-4

DIOPT Version :9

Sequence 1:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_508641.2 Gene:aex-4 / 188509 WormBaseID:WBGene00006454 Length:234 Species:Caenorhabditis elegans


Alignment Length:220 Identity:58/220 - (26%)
Similarity:112/220 - (50%) Gaps:15/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSEEVAPQVPKTELEELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEE 69
            |:||...:..|.::.:|......:..:||:|:.:|:...::.....::|..||:||.||||:||.
 Worm    16 PTEETVQKRIKLKMVDLDAEIAKLNVQSLDSSIQMIRDIDQMNVDAVQTTAALEDQDEQLDKIEA 80

  Fly    70 GMDQINADMREAEKNLSGMEKCCGIC----VLPCNKSQSFKEDDGTWKGNDDGKVVNNQPQRVMD 130
            .:..:..|:.....|::.||..|| |    :|........|.:....|.....|:.:.:.:| .:
 Worm    81 NLSNVIDDLNVVSHNITAMEHYCG-CGFFRILRAPFKYFRKRERDIIKEEVLEKMTSPKLRR-KE 143

  Fly   131 DRNGMM---------AQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQI 186
            :.|.||         :...::.|:|.||.|||:|.|:.|::..:.:::|:|:||..:|:.|..::
 Worm   144 ESNMMMFTNSSKRRESTGDFMKRLTCDAIEDELERNLMQIDQGLESVKNLAVDMHVQLKLQEPKL 208

  Fly   187 DRINRKGESNEARIAVANQRAHQLL 211
            :||....|:|:..:...|.:..:||
 Worm   209 NRIEELTETNDFVVEGVNDKVKKLL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 17/58 (29%)
SNAP-25 98..149 CDD:279208 9/59 (15%)
SNARE_SNAP25C 151..209 CDD:277238 17/57 (30%)
aex-4NP_508641.2 SNARE 31..99 CDD:304603 18/67 (27%)
SNARE 173..231 CDD:304603 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.