DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap25 and ric-4

DIOPT Version :9

Sequence 1:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001123033.1 Gene:ric-4 / 179427 WormBaseID:WBGene00004364 Length:234 Species:Caenorhabditis elegans


Alignment Length:213 Identity:122/213 - (57%)
Similarity:157/213 - (73%) Gaps:12/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPADPSEEVAPQVPKTELEELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLD 65
            :|||.|:         ||:.|.:.......|||||||||||||||||||||:|||.||||||||:
 Worm    30 LPADMSD---------ELKGLNVGIDEKTIESLESTRRMLALCEESKEAGIKTLVMLDDQGEQLE 85

  Fly    66 RIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQSFKEDD--GTWKGNDDGKVVNNQPQRV 128
            |.|..:|.||.||:|||.:|.|||||||:||||.||:..|::.:  ..||.:|||.|:::||:..
 Worm    86 RCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWNKTDDFEKTEFAKAWKKDDDGGVISDQPRIT 150

  Fly   129 MDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKG 193
            :.| :.|..|.|||.:||||||||||:||:.||:||:|||||||:||.:|:.|||||:|||:.|.
 Worm   151 VGD-SSMGPQGGYITKITNDAREDEMDENVQQVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKA 214

  Fly   194 ESNEARIAVANQRAHQLL 211
            :|||.|:..||:||..|:
 Worm   215 QSNEVRVESANKRAKNLI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 43/58 (74%)
SNAP-25 98..149 CDD:279208 21/52 (40%)
SNARE_SNAP25C 151..209 CDD:277238 37/57 (65%)
ric-4NP_001123033.1 SNARE_SNAP25N_23N 45..107 CDD:277242 43/61 (70%)
SNAP-25 118..170 CDD:279208 21/52 (40%)
SNARE_SNAP25C 172..230 CDD:277238 37/57 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164670
Domainoid 1 1.000 115 1.000 Domainoid score I3775
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H83182
Inparanoid 1 1.050 237 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60093
OrthoDB 1 1.010 - - D1197028at2759
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - otm14169
orthoMCL 1 0.900 - - OOG6_102919
Panther 1 1.100 - - LDO PTHR19305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3593
SonicParanoid 1 1.000 - - X1125
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.