DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap25 and Snap29

DIOPT Version :9

Sequence 1:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_446262.3 Gene:Snap29 / 116500 RGDID:620225 Length:257 Species:Rattus norvegicus


Alignment Length:233 Identity:48/233 - (20%)
Similarity:100/233 - (42%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PQVPKTELEELQINAQGV---ADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEEGMD 72
            |..|...::..|...|.|   |:.:..||.|.|:|..||::.|:.:...|..|...|:..|:.:|
  Rat    32 PDGPDAPIDRQQYLRQEVLRRAEATAASTSRSLSLMYESEKIGVASSEELVRQRGVLEHTEKMVD 96

  Fly    73 QINADMREAEKNLSGMEKCCGICVLPCNKSQSFKEDDGTWKGNDDGKVVNNQPQRV-------MD 130
            :::.|::.::|:::.::...|..:      ..||..........:|.:|.....|:       .|
  Rat    97 KMDQDLKMSQKHINSIKSVFGGFI------NYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKD 155

  Fly   131 DRNGMMAQAGYIGRITNDARED-----------------------EMEENMGQVNTMIGNLRNMA 172
            ..:...|....:.|: :||..|                       :::.|:.:::..:|.|:::|
  Rat   156 QESKYQASHPNLRRL-HDAELDSVPASTVNTEVYPKNSSLRAYHQKIDSNLDELSVGLGRLKDIA 219

  Fly   173 LDMGSELENQNRQIDRINRKGESNEARIAVANQRAHQL 210
            |.|.:|:|.|:..:||:..|.:..:..|....::..||
  Rat   220 LGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKKVRQL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 17/61 (28%)
SNAP-25 98..149 CDD:279208 8/57 (14%)
SNARE_SNAP25C 151..209 CDD:277238 14/80 (18%)
Snap29NP_446262.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 2/9 (22%)
SNARE_SNAP29N 47..111 CDD:277240 18/63 (29%)
SNARE_SNAP29C 198..256 CDD:277209 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.