DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and UBC14

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001190096.1 Gene:UBC14 / 824704 AraportID:AT3G55380 Length:201 Species:Arabidopsis thaliana


Alignment Length:199 Identity:108/199 - (54%)
Similarity:138/199 - (69%) Gaps:34/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEY 65
            |:..|:||||:|||.:|.|.||:||||||:||.::|:|.|.|:||||||||||||.|.:.||:.|
plant     1 MANNQASLLLQKQLKDLCKKPVDGFSAGLVDEKNVFQWSVSIMGPPDTLYEGGFFNAIMSFPENY 65

  Fly    66 PLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHT-VET---------- 119
            |:.||.:.|.:|:||||:..:|.|||||||.||||..|||.|||||.|||| |||          
plant    66 PVSPPTVTFTSEMWHPNVYSDGKVCISILHPPGDDPHGYELASERWTPVHTLVETDMFCSILSLY 130

  Fly   120 -----------------------ILISVISMLADPNDESPANVDAAKEWRESYTDFKRKVARCVR 161
                                   |::|:||||:.|||||||||:||||||::..:|::||:||||
plant   131 SDCFSNVRGIYKSGLRNTLEDKSIVLSIISMLSGPNDESPANVEAAKEWRDNRAEFRKKVSRCVR 195

  Fly   162 KSQE 165
            :|||
plant   196 RSQE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 97/183 (53%)
UBC14NP_001190096.1 COG5078 19..197 CDD:227410 95/177 (54%)
UQ_con 19..194 CDD:278603 92/174 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 224 1.000 Domainoid score I691
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I1079
OMA 1 1.010 - - QHG54250
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - mtm1144
orthoMCL 1 0.900 - - OOG6_101758
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.