DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and UBC13

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_566884.1 Gene:UBC13 / 823796 AraportID:AT3G46460 Length:166 Species:Arabidopsis thaliana


Alignment Length:161 Identity:110/161 - (68%)
Similarity:134/161 - (83%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRP 69
            |:.|||:|||.:|.|:||:||||||:||.:||.|.|.||||||||||||||.|.:.||:.||..|
plant     4 QACLLLQKQLKDLCKHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLYEGGFFYAIMSFPQNYPNSP 68

  Fly    70 PRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDE 134
            |.::|.::|||||:..:|.|||||||.||||..|||.|||||.||||||:|::|:||||:.||||
plant    69 PTVRFTSDIWHPNVYPDGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLSIISMLSGPNDE 133

  Fly   135 SPANVDAAKEWRESYTDFKRKVARCVRKSQE 165
            |||||:|||||||...:||:||:||||||||
plant   134 SPANVEAAKEWREKRDEFKKKVSRCVRKSQE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 100/149 (67%)
UBC13NP_566884.1 UQ_con 18..159 CDD:395127 95/140 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 224 1.000 Domainoid score I691
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2508
Inparanoid 1 1.050 241 1.000 Inparanoid score I1079
OMA 1 1.010 - - QHG54250
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - mtm1144
orthoMCL 1 0.900 - - OOG6_101758
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2092
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.