DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and ube2t

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001070763.1 Gene:ube2t / 768152 ZFINID:ZDB-GENE-061013-547 Length:194 Species:Danio rerio


Alignment Length:141 Identity:45/141 - (31%)
Similarity:71/141 - (50%) Gaps:18/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKKQLAELNKNPVEGFSA----GLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPP 70
            ||:::..|...|..|.|.    |.:||     .:..|:|..:|.||||.|...:..|:.||..||
Zfish     7 LKREMQLLTAEPPPGVSCWQSEGRLDE-----LQAQIVGGANTPYEGGVFTLEINIPERYPFEPP 66

  Fly    71 RMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDES 135
            :|:|:|.|:||||:..|.:|:..|..|         ....|.|...:.|:|.|:..::|:||.:.
Zfish    67 KMRFLTPIYHPNIDNAGRICLDALKLP---------PKGAWRPSLNISTVLTSIQLLMAEPNPDD 122

  Fly   136 PANVDAAKEWR 146
            |...|.:.|::
Zfish   123 PLMADISSEFK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 45/141 (32%)
ube2tNP_001070763.1 COG5078 1..152 CDD:227410 45/141 (32%)
UBCc 4..147 CDD:238117 45/141 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..194
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.