DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ube2w

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_006495620.1 Gene:Ube2w / 66799 MGIID:1914049 Length:174 Species:Mus musculus


Alignment Length:157 Identity:47/157 - (29%)
Similarity:78/157 - (49%) Gaps:28/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQSSLLLKKQLAELNKNPVEGFSAGLIDE----NDIFRWEVLIIGPPDTLYEGGFFKAHLYF 61
            |:.:|..  |:|:|..|..:|..|.:   ::|    |.|.:|.|.:.|.|.|||||..|:....|
Mouse    30 MASMQKR--LQKELLALQNDPPPGMT---LNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKF 89

  Fly    62 PKEYPLRPPRMKFVTE--IWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISV 124
            ...||...|::.|..|  ..||::..||.:|:|||             :|.|.|..:|:::.:|:
Mouse    90 SSRYPFDSPQVMFTGENIPIHPHVYSNGHICLSIL-------------TEDWSPALSVQSVCLSI 141

  Fly   125 ISMLADPNDESPANVDAAK----EWRE 147
            ||||:...::..:.::..|    :|.|
Mouse   142 ISMLSSCKEKILSLMEVGKRPDEKWCE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 45/148 (30%)
Ube2wXP_006495620.1 UQ_con 36..>148 CDD:365926 42/129 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.