DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ube2g1

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_073181.1 Gene:Ube2g1 / 64631 RGDID:620392 Length:170 Species:Rattus norvegicus


Alignment Length:166 Identity:139/166 - (83%)
Similarity:157/166 - (94%) Gaps:1/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEY 65
            |:||||:|||::|||||||||||||||||||:||::|||||||||||||||||.|||||.|||:|
  Rat     1 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDY 65

  Fly    66 PLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLAD 130
            |||||:|||:|||||||::||||||||||||||:||:||||..|||||:||||||:|||||||||
  Rat    66 PLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLAD 130

  Fly   131 PNDESPANVDAAKEWRESYT-DFKRKVARCVRKSQE 165
            ||.:|||||||||||||... :||||||||||||||
  Rat   131 PNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 125/150 (83%)
Ube2g1NP_073181.1 UQ_con 10..161 CDD:395127 125/150 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336930
Domainoid 1 1.000 277 1.000 Domainoid score I1666
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2508
Inparanoid 1 1.050 301 1.000 Inparanoid score I2604
OMA 1 1.010 - - QHG54250
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - otm44513
orthoMCL 1 0.900 - - OOG6_101758
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2092
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.