DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and ube2wa

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001116444.1 Gene:ube2wa / 553013 ZFINID:ZDB-GENE-050506-94 Length:151 Species:Danio rerio


Alignment Length:147 Identity:44/147 - (29%)
Similarity:70/147 - (47%) Gaps:30/147 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQSSLLLKKQLAELNKNPVEGFSAGLIDE----NDIFRWEVLIIGPPDTLYEGGFFKAHLYF 61
            |:.:|..  |:|:|..|..:|..|.:   ::|    |.|..|.:.:.|...|:|||..|:....|
Zfish     1 MASMQKR--LQKELLALQNDPPAGMT---LNERSVQNTITEWFIDMEGAQGTVYEGEKFQLLFKF 60

  Fly    62 PKEYPLRPPRMKFVTE--IWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISV 124
            ...||...|::.|..|  ..||::..||.:|:|||             :|.|.|..:|:::.:|:
Zfish    61 SSRYPFESPQVMFTGENIPVHPHVYSNGHICLSIL-------------TEDWSPALSVQSVCLSI 112

  Fly   125 ISMLAD------PNDES 135
            ||||:.      |.|.|
Zfish   113 ISMLSSCKEKRRPPDNS 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 42/138 (30%)
ube2waNP_001116444.1 UQ_con 7..148 CDD:278603 42/141 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.