DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and ube2d3

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001016064.1 Gene:ube2d3 / 548818 XenbaseID:XB-GENE-972278 Length:147 Species:Xenopus tropicalis


Alignment Length:149 Identity:52/149 - (34%)
Similarity:84/149 - (56%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKF 74
            :.|:|.:|.::|....|||.:.: |:|.|:..|:||.|:.|:||.|...::||.:||.:||::.|
 Frog     6 IHKELNDLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAF 69

  Fly    75 VTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPANV 139
            .|.|:||||..||.:|:.||.             .:|.|..|:..:|:|:.|:|.|||.:.|...
 Frog    70 TTRIYHPNINSNGSICLDILR-------------SQWSPALTISKVLLSICSLLCDPNPDDPLVP 121

  Fly   140 DAAKEW---RESYTDFKRK 155
            :.|:.:   ||.|....|:
 Frog   122 EIARIYKTDREKYNRIARE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 52/149 (35%)
ube2d3NP_001016064.1 UBCc 1..146 CDD:412187 52/149 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.