DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and ube2z

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001002330.2 Gene:ube2z / 436602 ZFINID:ZDB-GENE-040718-15 Length:380 Species:Danio rerio


Alignment Length:166 Identity:51/166 - (30%)
Similarity:79/166 - (47%) Gaps:21/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRP 69
            |..|.:|:.:..:.|.|..|... :.|.:|:.:...||.||.||.||||||......|.:||:.|
Zfish   123 QCILRIKRDIMSIYKEPPPGMFV-VPDPHDMTKIHALITGPFDTPYEGGFFLFLFRCPPDYPIHP 186

  Fly    70 PRMKFVTE-----IWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLA 129
            ||:|.:|.     .::||..:||.||:|||     ..|    ....|.|..::.::|||:.|::.
Zfish   187 PRVKLITTGHNTVRFNPNFYRNGKVCLSIL-----GTW----TGPAWSPAQSISSVLISIQSLMT 242

  Fly   130 ------DPNDESPANVDAAKEWRESYTDFKRKVARC 159
                  :|..|...:...:|.:.|.......:||.|
Zfish   243 ENPYHNEPGFEQERHPGDSKNYNECIRHETMRVAVC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 49/161 (30%)
ube2zNP_001002330.2 UBCc 127..245 CDD:238117 42/127 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.