DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and CG5823

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:125 Identity:35/125 - (28%)
Similarity:60/125 - (48%) Gaps:21/125 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKF 74
            :|:....|.::|:...:|..: .|:|..|...:.||.|:.|.||::...|.||:|:|.:||.:..
  Fly    19 MKQDYMRLKRDPLPYITAEPL-PNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSIYM 82

  Fly    75 VTEIWHPN--IEKNGDVCISI--LHEPGDDKWGYEKASERWLPVHTVETILISVISMLAD 130
            :|    ||  .:.|..:|:||  .|            .:.|.|...|.|||..::|.:.:
  Fly    83 LT----PNGRFKTNTRLCLSISDFH------------PDTWNPTWCVGTILTGLLSFMLE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 35/125 (28%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 35/125 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.