DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ubc87F

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster


Alignment Length:166 Identity:138/166 - (83%)
Similarity:156/166 - (93%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEY 65
            |||||:||||.:||:||.::|||||||||:.::|||:|||:||||||||||||||||||.|||||
  Fly     1 MSELQASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEY 65

  Fly    66 PLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLAD 130
            |||||:|||:||||||||:|.|||||||||||||||||||||.|||||||||||||:||||||.|
  Fly    66 PLRPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTD 130

  Fly   131 PNDESPANVDAAKEWRESYTDFKRKVARCVRKSQEE 166
            |||||.||||||||:||:|.:|||||.||||:||||
  Fly   131 PNDESAANVDAAKEYRENYAEFKRKVTRCVRRSQEE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 123/149 (83%)
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 134/161 (83%)
UQ_con 10..160 CDD:278603 123/149 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442270
Domainoid 1 1.000 224 1.000 Domainoid score I691
eggNOG 1 0.900 - - E2759_KOG0425
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I1079
Isobase 1 0.950 - 0 Normalized mean entropy S254
OMA 1 1.010 - - QHG54250
OrthoDB 1 1.010 - - D118909at6960
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - mtm6562
orthoMCL 1 0.900 - - OOG6_101758
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1582
SonicParanoid 1 1.000 - - X2092
1413.790

Return to query results.
Submit another query.