DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and ube2na

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_998651.1 Gene:ube2na / 406807 ZFINID:ZDB-GENE-040426-2873 Length:154 Species:Danio rerio


Alignment Length:135 Identity:47/135 - (34%)
Similarity:79/135 - (58%) Gaps:14/135 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKFVT 76
            |:...|...||.|..|. .||.:...:.|:|.||.|:.:|||.||..|:.|:|||:..|:::|:|
Zfish    10 KETQRLLAEPVPGIKAE-PDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMT 73

  Fly    77 EIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPANVDA 141
            :|:|||::|.|.:|:.||             .::|.|...:.|:|:|:.::|:.||.:.|...|.
Zfish    74 KIYHPNVDKLGRICLDIL-------------KDKWSPALQIRTVLLSIQALLSAPNPDDPLANDV 125

  Fly   142 AKEWR 146
            |::|:
Zfish   126 AEQWK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 47/135 (35%)
ube2naNP_998651.1 UBCc 4..151 CDD:412187 47/135 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.