DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and CG7656

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:157 Identity:81/157 - (51%)
Similarity:107/157 - (68%) Gaps:9/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKF 74
            |..:...|.:.|||||...||:::::|.|||.|.|||||||:||:||||:.||.:||..||.::|
  Fly    45 LAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRF 109

  Fly    75 VTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPANV 139
            :|::||||:.:|||:||||||.|.||....|...|||.|...|.|||:||||:|.:||..|||||
  Fly   110 LTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPANV 174

  Fly   140 DAA---KEWRES------YTDFKRKVA 157
            ||:   :.||:|      |.:..||.|
  Fly   175 DASVMYRRWRDSQGKDNEYPNIIRKQA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 81/157 (52%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 76/140 (54%)
COG5078 45..182 CDD:227410 74/136 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438102
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.