DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and ube2g1

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_989051.1 Gene:ube2g1 / 394648 XenbaseID:XB-GENE-949494 Length:170 Species:Xenopus tropicalis


Alignment Length:166 Identity:138/166 - (83%)
Similarity:157/166 - (94%) Gaps:1/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEY 65
            |:||||:|||::|||||||||||||||||||:||::|||||||||||||||||.|||||.||::|
 Frog     1 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPRDY 65

  Fly    66 PLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLAD 130
            |||||:|||:|||||||::||||||||||||||:||:||||..|||||:||||||:|||||||||
 Frog    66 PLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLAD 130

  Fly   131 PNDESPANVDAAKEWRESYT-DFKRKVARCVRKSQE 165
            ||.:|||||||||||||... :||||||||||||||
 Frog   131 PNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 124/150 (83%)
ube2g1NP_989051.1 UQ_con 10..161 CDD:365926 124/150 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 276 1.000 Domainoid score I1719
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2508
Inparanoid 1 1.050 300 1.000 Inparanoid score I2656
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - otm47550
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1582
SonicParanoid 1 1.000 - - X2092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.