DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and ube2d1a

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_957404.1 Gene:ube2d1a / 394085 ZFINID:ZDB-GENE-040426-1609 Length:147 Species:Danio rerio


Alignment Length:154 Identity:54/154 - (35%)
Similarity:84/154 - (54%) Gaps:28/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKF 74
            ::|:|.:|.::|....|||.:.| |:|.|:..|:||.|:.|:||.|...::||.:||.:||::.|
Zfish     6 IQKELQDLQRDPPSQCSAGPLGE-DLFHWQATIMGPGDSPYQGGVFFLTIHFPTDYPFKPPKVAF 69

  Fly    75 VTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPANV 139
            .|:|:||||..||.:|:.||.             .:|.|..||..:|:|:.|:|.|||.:.|...
Zfish    70 TTKIYHPNINSNGSICLDILR-------------SQWSPALTVSKVLLSICSLLCDPNPDDPLVP 121

  Fly   140 D--------------AAKEWRESY 149
            |              .|:||.:.|
Zfish   122 DIAHIYKSDKDKYNRLAREWTQKY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 54/154 (35%)
ube2d1aNP_957404.1 COG5078 1..147 CDD:227410 54/154 (35%)
UBCc 1..146 CDD:294101 54/154 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.