DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ube2u

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001028945.2 Gene:Ube2u / 381534 MGIID:3588216 Length:352 Species:Mus musculus


Alignment Length:137 Identity:40/137 - (29%)
Similarity:73/137 - (53%) Gaps:13/137 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRM 72
            :||:::..||.::..:..:|..:.: |:..|:..|.|..:::.||..|...|.|.:||...||.:
Mouse     7 ILLEREFRELKRDTRKDITAYPVSD-DMMNWKAEIEGLRNSVCEGLVFYLTLEFSQEYNSVPPNV 70

  Fly    73 KFVTEIWHPNIEK-NGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESP 136
            ||.|..:|||::. .|...|..|.:||           :|...:||.:||:.:..:|:.|..::|
Mouse    71 KFTTIPFHPNVDPYTGKPSIDFLDKPG-----------KWNTNYTVLSILLDLQMLLSYPVLKNP 124

  Fly   137 ANVDAAK 143
            .|::||:
Mouse   125 VNLEAAQ 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 39/135 (29%)
Ube2uNP_001028945.2 COG5078 1..146 CDD:227410 40/137 (29%)
UBCc 8..146 CDD:238117 40/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.