DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and CG7220

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster


Alignment Length:137 Identity:43/137 - (31%)
Similarity:68/137 - (49%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKKQLAELNKNPVEGFSAGLID----ENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPP 70
            |.|:|..|.|.|..|.:   ||    :.::..|::.|.|...|||||..|:....|..:||...|
  Fly    47 LHKELMSLIKEPPPGVT---IDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSP 108

  Fly    71 RMKFV-TEI-WHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPND 133
            .:.|: |.| .||::..||.:|:|||             :|.|.|..:|:::.:|:.|||:...:
  Fly   109 EVTFIGTNIPVHPHVYSNGHICLSIL-------------TEDWSPALSVQSVCLSIASMLSSCRE 160

  Fly   134 ES--PAN 138
            :.  |.|
  Fly   161 KKRPPDN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 43/137 (31%)
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 43/137 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.