DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and CG7220

DIOPT Version :10

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_724964.2 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster


Alignment Length:137 Identity:43/137 - (31%)
Similarity:68/137 - (49%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKKQLAELNKNPVEGFSAGLID----ENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPP 70
            |.|:|..|.|.|..|.:   ||    :.::..|::.|.|...|||||..|:....|..:||...|
  Fly    47 LHKELMSLIKEPPPGVT---IDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSP 108

  Fly    71 RMKFV-TEI-WHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPND 133
            .:.|: |.| .||::..||.:|:|||             :|.|.|..:|:::.:|:.|||:...:
  Fly   109 EVTFIGTNIPVHPHVYSNGHICLSIL-------------TEDWSPALSVQSVCLSIASMLSSCRE 160

  Fly   134 ES--PAN 138
            :.  |.|
  Fly   161 KKRPPDN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UBCc_UBE2G1 5..159 CDD:467415 43/137 (31%)
CG7220NP_724964.2 UBCc_UBE2W 44..164 CDD:467428 41/132 (31%)

Return to query results.
Submit another query.