DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and lwr

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster


Alignment Length:119 Identity:38/119 - (31%)
Similarity:65/119 - (54%) Gaps:11/119 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKW 102
            ||..|.|...|.:|||.:|..:.|..:||..||:.||...::|||:..:|.||:|:|.|..|   
  Fly    41 WECAIPGKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD--- 102

  Fly   103 GYEKASERWLPVHTVETILISVISMLADPNDESPANVDAAKEWRESYTDFKRKV 156
                    |.|..|::.||:.:..:|.:||.:.||..:|...:.::..:::::|
  Fly   103 --------WRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQNRLEYEKRV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 38/119 (32%)
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 38/119 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.