DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and ben

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster


Alignment Length:165 Identity:53/165 - (32%)
Similarity:93/165 - (56%) Gaps:23/165 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEY 65
            ||.|...::  |:...|.:.||.|.:| :.|||:...:.|::.||.|:.:|||.||..|:.|::|
  Fly     1 MSSLPRRII--KETQRLMQEPVPGINA-IPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDY 62

  Fly    66 PLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLAD 130
            |:..|:::|:|:|:||||::.|.:|:.:|             .::|.|...:.|||:|:.::|:.
  Fly    63 PMSAPKVRFITKIYHPNIDRLGRICLDVL-------------KDKWSPALQIRTILLSIQALLSA 114

  Fly   131 PNDESPANVDAAKEWRESYTDFKRKVARCVRKSQE 165
            ||.:.|...|.|:.|       |...|..:|.::|
  Fly   115 PNPDDPLANDVAELW-------KVNEAEAIRNARE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 48/149 (32%)
benNP_001162752.1 UBCc 3..149 CDD:412187 51/163 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.