DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ube2z

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001032732.2 Gene:Ube2z / 303478 RGDID:1308347 Length:356 Species:Rattus norvegicus


Alignment Length:166 Identity:51/166 - (30%)
Similarity:78/166 - (46%) Gaps:21/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRP 69
            |..|.:|:.:..:.|.|..|... :.|..|:.:...||.||.||.||||||......|.:||:.|
  Rat   101 QCLLRIKRDIMSIYKEPPPGMFV-VPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHP 164

  Fly    70 PRMKFVTE-----IWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLA 129
            ||:|.:|.     .::||..:||.||:|||     ..|    ....|.|..::.::|||:.|::.
  Rat   165 PRVKLMTTGNNTVRFNPNFYRNGKVCLSIL-----GTW----TGPAWSPAQSISSVLISIQSLMT 220

  Fly   130 ------DPNDESPANVDAAKEWRESYTDFKRKVARC 159
                  :|..|...:...:|.:.|.......:||.|
  Rat   221 ENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 49/161 (30%)
Ube2zNP_001032732.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
UBCc 105..223 CDD:238117 42/127 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.