DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ube2j1

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001100112.2 Gene:Ube2j1 / 297961 RGDID:1305067 Length:318 Species:Rattus norvegicus


Alignment Length:159 Identity:44/159 - (27%)
Similarity:79/159 - (49%) Gaps:26/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKF 74
            |.|:.||| |:|.:.:.|..:::| :|.|...:.||||:.::||.:...:..|.|||::||.:..
  Rat    15 LMKEAAEL-KDPTDHYHAQPLEDN-LFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIIL 77

  Fly    75 VTEIWHPNIEKNGDVCISIL-HEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPAN 138
            :|.  :...|....:|:||. |.|           |.|.|..::.|.|:::|..:....:.:..:
  Rat    78 LTA--NGRFEVGKKICLSISGHHP-----------ETWQPSWSIRTALLAIIGFMPTKGEGAIGS 129

  Fly   139 VDAAKEWRESYTDFKRKVARCVRKSQEEC 167
            :|        ||..:|:.  ..:|||:.|
  Rat   130 LD--------YTPEERRA--LAKKSQDFC 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 40/150 (27%)
Ube2j1NP_001100112.2 UBCc 12..>119 CDD:238117 36/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.