DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ube2k

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_038947644.1 Gene:Ube2k / 289623 RGDID:1311626 Length:210 Species:Rattus norvegicus


Alignment Length:142 Identity:48/142 - (33%)
Similarity:79/142 - (55%) Gaps:20/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AELNKNPVEGFSAGLIDEN-DIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKFVTEI 78
            ||.:||.::   ..|:||| ...|.|  |.|||||.||||.::..:..|:.||..||:::|:|:|
  Rat    30 AETSKNQIK---VDLVDENFTELRGE--IAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKI 89

  Fly    79 WHPNIEK-NGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPANVDAA 142
            |||||.. .|.:|:.||             .::|....|:.|:|:|:.::||....:.|.:...|
  Rat    90 WHPNISSVTGAICLDIL-------------KDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVA 141

  Fly   143 KEWRESYTDFKR 154
            .:::::...||:
  Rat   142 NQYKQNPEMFKQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 48/142 (34%)
Ube2kXP_038947644.1 UBCc 35..159 CDD:238117 45/137 (33%)
UBA_II_E2_UBE2K 173..210 CDD:270573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.