DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and ubc15

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_596465.1 Gene:ubc15 / 2539995 PomBaseID:SPBC1105.09 Length:167 Species:Schizosaccharomyces pombe


Alignment Length:165 Identity:113/165 - (68%)
Similarity:134/165 - (81%) Gaps:0/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEY 65
            |....|..||:|||.|:.|||.:|||.||:|:..||.|||:||||.|||||||||.|.|.||::|
pombe     1 MPSSASEQLLRKQLKEIQKNPPQGFSVGLVDDKSIFEWEVMIIGPEDTLYEGGFFHATLSFPQDY 65

  Fly    66 PLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLAD 130
            ||.||:|||.|||||||:..||:|||||||.|||||:|||.|.|||||||:.|||||||||||:.
pombe    66 PLMPPKMKFTTEIWHPNVHPNGEVCISILHPPGDDKYGYEDAGERWLPVHSPETILISVISMLSS 130

  Fly   131 PNDESPANVDAAKEWRESYTDFKRKVARCVRKSQE 165
            ||||||||:|||||:||:..:||::|.|.||:|.|
pombe   131 PNDESPANIDAAKEFRENPQEFKKRVRRLVRRSIE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 106/149 (71%)
ubc15NP_596465.1 COG5078 1..152 CDD:227410 105/150 (70%)
UQ_con 10..152 CDD:278603 102/141 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 235 1.000 Domainoid score I480
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2508
Inparanoid 1 1.050 244 1.000 Inparanoid score I807
OMA 1 1.010 - - QHG54250
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - otm47005
orthoMCL 1 0.900 - - OOG6_101758
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1582
SonicParanoid 1 1.000 - - X2092
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.