DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ube2g2

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_062777.2 Gene:Ube2g2 / 22213 MGIID:1343188 Length:165 Species:Mus musculus


Alignment Length:157 Identity:87/157 - (55%)
Similarity:111/157 - (70%) Gaps:3/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKKQLAE---LNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPR 71
            ||:.:||   |..||.||..||.::|.:.|.||.||:||.||.:|.|.|.|.|.||.:|||.||:
Mouse     6 LKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPK 70

  Fly    72 MKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESP 136
            |:|..|::||||..:|.|||||||.||||..|||.::|||.||.:||.||:||:||||:|||||.
Mouse    71 MRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESG 135

  Fly   137 ANVDAAKEWRESYTDFKRKVARCVRKS 163
            |||||:|.||:....|.:...:.|:||
Mouse   136 ANVDASKMWRDDREQFYKIAKQIVQKS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 84/152 (55%)
Ube2g2NP_062777.2 COG5078 1..163 CDD:227410 87/157 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.