DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ube2i

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001171080.1 Gene:Ube2i / 22196 MGIID:107365 Length:158 Species:Mus musculus


Alignment Length:166 Identity:51/166 - (30%)
Similarity:83/166 - (50%) Gaps:16/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQSSLLLKKQLAELNKNPVEGFSAGLIDEND----IFRWEVLIIGPPDTLYEGGFFKAHLYF 61
            ||.:..|.|.:::.|....:|. ||.|......|    :..||..|.|...|.:|||.||..:.|
Mouse     1 MSGIALSRLAQERKAWRKDHPF-GFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLF 64

  Fly    62 PKEYPLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVIS 126
            ..:||..||:.||...::|||:..:|.||:|||.|..|           |.|..|::.||:.:..
Mouse    65 KDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD-----------WRPAITIKQILLGIQE 118

  Fly   127 MLADPNDESPANVDAAKEWRESYTDFKRKVARCVRK 162
            :|.:||.:.||..:|...:.::..:::::|....:|
Mouse   119 LLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 46/153 (30%)
Ube2iNP_001171080.1 UQ_con 8..152 CDD:395127 47/155 (30%)
Interaction with SUMO1. /evidence=ECO:0000250 13..18 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.