DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ube2e3

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001343324.1 Gene:Ube2e3 / 22193 MGIID:107412 Length:207 Species:Mus musculus


Alignment Length:158 Identity:51/158 - (32%)
Similarity:79/158 - (50%) Gaps:28/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPP 70
            |:..::|:|||:..:|....|||...:| |:.|...|:|||.::||||.|...:.|..:||.:||
Mouse    62 SAKRIQKELAEITLDPPPNCSAGPKGDN-IYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPP 125

  Fly    71 RMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDES 135
            ::.|.|.|:|.||...|.:|:.||             .:.|.|..|:..:|:|:.|:|.|.|...
Mouse   126 KVTFRTRIYHCNINSQGVICLDIL-------------KDNWSPALTISKVLLSICSLLTDCNPAD 177

  Fly   136 P-------------ANVD-AAKEWRESY 149
            |             |..| .|::|.:.|
Mouse   178 PLVGSIATQYLTNRAEHDRIARQWTKRY 205

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 50/154 (32%)