DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and Ube2e1

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_038949665.1 Gene:Ube2e1 / 100366017 RGDID:2324438 Length:310 Species:Rattus norvegicus


Alignment Length:158 Identity:51/158 - (32%)
Similarity:79/158 - (50%) Gaps:28/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPP 70
            |:..::|:||::..:|....|||...:| |:.|...|:|||.::||||.|...:.|..|||.:||
  Rat   165 SAKRIQKELADITLDPPPNCSAGPKGDN-IYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPP 228

  Fly    71 RMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDES 135
            ::.|.|.|:|.||...|.:|:.||             .:.|.|..|:..:|:|:.|:|.|.|...
  Rat   229 KVTFRTRIYHCNINSQGVICLDIL-------------KDNWSPALTISKVLLSICSLLTDCNPAD 280

  Fly   136 P-------------ANVD-AAKEWRESY 149
            |             |..| .|::|.:.|
  Rat   281 PLVGSIATQYMTNRAEHDRMARQWTKRY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 50/154 (32%)
Ube2e1XP_038949665.1 PHA03378 <19..>108 CDD:223065
UQ_con 168..305 CDD:395127 48/150 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.