DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40045 and ube2g1b

DIOPT Version :9

Sequence 1:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_998695.1 Gene:ube2g1b / 100000479 ZFINID:ZDB-GENE-040426-2939 Length:169 Species:Danio rerio


Alignment Length:166 Identity:131/166 - (78%)
Similarity:154/166 - (92%) Gaps:2/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEY 65
            |:| ||:|||:||||||||||||||||||||::||::|||::|||.||::|||||||||.||.:|
Zfish     1 MTE-QSALLLRKQLAELNKNPVEGFSAGLIDDDDIYQWEVVVIGPQDTMFEGGFFKAHLIFPHDY 64

  Fly    66 PLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLAD 130
            |||||:|||:|||||||:.||||||||||||||:||:||||..|||||:||||||:|||||||||
Zfish    65 PLRPPKMKFITEIWHPNVAKNGDVCISILHEPGEDKFGYEKPEERWLPIHTVETIMISVISMLAD 129

  Fly   131 PNDESPANVDAAKEWRESYT-DFKRKVARCVRKSQE 165
            ||.:||||||||||||:... :||||||||||:|||
Zfish   130 PNGDSPANVDAAKEWRDDPNGEFKRKVARCVRRSQE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 119/150 (79%)
ube2g1bNP_998695.1 COG5078 1..163 CDD:227410 128/162 (79%)
UQ_con 9..160 CDD:278603 119/150 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 278 1.000 Domainoid score I1682
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 299 1.000 Inparanoid score I2676
OMA 1 1.010 - - QHG54250
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - mtm6562
orthoMCL 1 0.900 - - OOG6_101758
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1582
SonicParanoid 1 1.000 - - X2092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.