DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and HGS

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_004703.1 Gene:HGS / 9146 HGNCID:4897 Length:777 Species:Homo sapiens


Alignment Length:337 Identity:73/337 - (21%)
Similarity:110/337 - (32%) Gaps:140/337 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 RNHNAAQRILDRFPTAAEQMDIRGRNFLHLAILKDDLESVLFL--LAIQVD------VNSRVHDA 856
            |.....:|:||:   |..|:           :|:.|.||:|.:  |..|.|      |||.....
Human     3 RGSGTFERLLDK---ATSQL-----------LLETDWESILQICDLIRQGDTQAKYAVNSIKKKV 53

  Fly   857 NQSSPLHLAAASQNEMITRNLILAGARMNERDAVQKLPLHIAIERGNLPAVSALIQNNADYDATD 921
            |..:|                                  |:|:..  |..:.::::|        
Human    54 NDKNP----------------------------------HVALYA--LEVMESVVKN-------- 74

  Fly   922 ADGNNALHIAVRCAQFFIVRELLTESRVNAEATNLKGRNPLHELC-RVVEDSTAGLICELF---- 981
                        |.|           .|:.|..|.:....|.:|. |.||.:....|..|.    
Human    75 ------------CGQ-----------TVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWA 116

  Fly   982 --LESMPKYPI-----NIPDMDGNTPLLLSFMRGQSPLCKILVKAGACLGTENKDGINIFNFKLA 1039
              ..:.|||.:     .|..::|:                        :..|.|:...:|..:.|
Human   117 HAFRNEPKYKVVQDTYQIMKVEGH------------------------VFPEFKESDAMFAAERA 157

  Fly  1040 TDQLLHNLLDQLPQESPWAESDYCQHCTNRFTITMRKHHCRHCGRVLCSKCSCNDVPILKFGINK 1104
            .|               |.:::.|..|..:|.:..||||||.||::.|.|||.....|.||||.|
Human   158 PD---------------WVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEK 207

  Fly  1105 PVRVCTVCFNVL 1116
            .||||..|:..|
Human   208 EVRVCEPCYEQL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125
ANK repeat 468..501 CDD:293786
Ank_2 473..572 CDD:289560
ANK repeat 503..539 CDD:293786
ANK 536..660 CDD:238125
ANK repeat 541..572 CDD:293786
ANK repeat 574..637 CDD:293786
Ank_2 579..670 CDD:289560
ANK repeat 639..670 CDD:293786
Ank_2 644..752 CDD:289560
ANK repeat 672..721 CDD:293786
ANK 721..843 CDD:238125 11/44 (25%)
ANK repeat 723..752 CDD:293786
ANKYR 752..977 CDD:223738 33/185 (18%)
ANK repeat 754..786 CDD:293786
ANK 820..944 CDD:238125 19/131 (15%)
ANK repeat 822..855 CDD:293786 11/40 (28%)
ANK repeat 857..888 CDD:293786 2/30 (7%)
ANK 885..1017 CDD:238125 21/143 (15%)
ANK repeat 890..921 CDD:293786 4/30 (13%)
ANK repeat 923..955 CDD:293786 4/31 (13%)
ANK repeat 996..1021 CDD:293786 1/24 (4%)
FYVE_ANFY1 1054..1116 CDD:277267 27/61 (44%)
HGSNP_004703.1 VHS_Hrs_Vps27p 4..145 CDD:239626 39/245 (16%)
FYVE_Hrs 159..219 CDD:277260 28/74 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..319
Interaction with SNX1. /evidence=ECO:0000250 225..543
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..407
Hrs_helical 407..501 CDD:289018
Interaction with SNAP25 and TRAK2. /evidence=ECO:0000250 445..543
Interaction with STAM. /evidence=ECO:0000250|UniProtKB:Q99LI8 454..572
Interaction with NF2. /evidence=ECO:0000269|PubMed:10861283 480..777
GBP_C <486..560 CDD:303769
DUF1421 519..>746 CDD:284607
coiled coil 531..542 CDD:293879
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 718..777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1818
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.