DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and RIPK2

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_003812.1 Gene:RIPK2 / 8767 HGNCID:10020 Length:540 Species:Homo sapiens


Alignment Length:641 Identity:132/641 - (20%)
Similarity:219/641 - (34%) Gaps:196/641 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IRSQTRVFPAHKIVLHARSEKWGNDLLSNIQQLDWSDLNEDVVLSLLRWIYTDLIDLQNDGLALD 142
            |.|.....|.||:.......:..:..:|:.:..||   ...|.:..|. |:|.|:|.:...:..:
Human     6 ICSALPTIPYHKLADLRYLSRGASGTVSSARHADW---RVQVAVKHLH-IHTPLLDSERKDVLRE 66

  Fly   143 ---LLKAAHRFGLPSLLGICERALVTSVGVRSCIRFYCVAEEVGASTLLEYCSSIISTHWDDLTT 204
               |.||...:.|| :||||..                 .|.:|..|                  
Human    67 AEILHKARFSYILP-ILGICNE-----------------PEFLGIVT------------------ 95

  Fly   205 DDFQHMSGPLLFEMLKTKTKHPLHA---AVRLLREDVVSLCIQKYGNSLVNTFSENGILPLEMAL 266
               ::|....|.|:|..||::|..|   ..|:|.|..:.:   .|.:::......:.:....:.|
Human    96 ---EYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGV---NYLHNMTPPLLHHDLKTQNILL 154

  Fly   267 SSK-NAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSANFLLDQNCLLDLPSKPSSDTAL 330
            .:: :.|||    |.|::....:::......|||.:.|...   ::..:|.   .|.:.|..:..
Human   155 DNEFHVKIA----DFGLSKWRMMSLSQSRSSKSAPEGGTII---YMPPENY---EPGQKSRASIK 209

  Fly   331 HIICNYGPDNTPEIMEVVKKILQRQ---------LNINIQNIKGETP------LHIAIARRNVEM 380
            |.|.:|.        .:..::|.|:         |.|.....:|..|      |...|..| ..|
Human   210 HDIYSYA--------VITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHR-ARM 265

  Fly   381 VKLL----LKVPNIDINLRTYDE-----KCALELSLSMGDHE---FLIASILLSMGARTDRTNSK 433
            :.|:    .:.|         ||     ||.:||...:...|   ||.|.|.|          .|
Human   266 ISLIESGWAQNP---------DERPSFLKCLIELEPVLRTFEEITFLEAVIQL----------KK 311

  Fly   434 TGDSLLQVFALDRHRGEKSAIFLADFADLDHINFRGLTALHIAALNNMPNLVKKLIVNGASSNLK 498
            |           :.:...|||.|.|...::       .:|:| .:|:.|               :
Human   312 T-----------KLQSVSSAIHLCDKKKME-------LSLNI-PVNHGP---------------Q 342

  Fly   499 HIDCGLKSALH----IAVEANAIDALEAFVELKNKSHDIDF----NC-------QDINGDSPLSL 548
            ...|| .|.||    ....:.::.|.:....|..|:.|..|    :|       ..|:|....:.
Human   343 EESCG-SSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAF 406

  Fly   549 CLSLKRTTLVPTLIRGGSDVNGKNKNNLSP--LHQSIKNEDSDISLFLLEQGADITALTENLDSA 611
            | ..|.|.....:|...|...  |...|.|  ..|.|:::..||...:.|     ..|.::||:.
Human   407 C-DHKTTPCSSAIINPLSTAG--NSERLQPGIAQQWIQSKREDIVNQMTE-----ACLNQSLDAL 463

  Fly   612 L--DLSIKHDLSEVVDALCRRGIALSINKNGESPLWSALE----KGYEDVAKILVR 661
            |  ||.:|.|...|           |......|.:...|:    :| |:.||::|:
Human   464 LSRDLIMKEDYELV-----------STKPTRTSKVRQLLDTTDIQG-EEFAKVIVQ 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045 23/88 (26%)
BTB 75..166 CDD:197585 23/90 (26%)
ANK 252..385 CDD:238125 27/152 (18%)
ANK repeat 291..322 CDD:293786 5/30 (17%)
ANK repeat 325..362 CDD:293786 8/45 (18%)
Ank_2 330..431 CDD:289560 27/127 (21%)
ANK 463..595 CDD:238125 29/148 (20%)
ANK repeat 468..501 CDD:293786 4/32 (13%)
Ank_2 473..572 CDD:289560 22/113 (19%)
ANK repeat 503..539 CDD:293786 10/50 (20%)
ANK 536..660 CDD:238125 32/138 (23%)
ANK repeat 541..572 CDD:293786 6/30 (20%)
ANK repeat 574..637 CDD:293786 17/66 (26%)
Ank_2 579..670 CDD:289560 22/89 (25%)
ANK repeat 639..670 CDD:293786 7/27 (26%)
Ank_2 644..752 CDD:289560 6/22 (27%)
ANK repeat 672..721 CDD:293786
ANK 721..843 CDD:238125
ANK repeat 723..752 CDD:293786
ANKYR 752..977 CDD:223738
ANK repeat 754..786 CDD:293786
ANK 820..944 CDD:238125
ANK repeat 822..855 CDD:293786
ANK repeat 857..888 CDD:293786
ANK 885..1017 CDD:238125
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
RIPK2NP_003812.1 STKc_RIP2 20..303 CDD:270928 68/356 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..369 8/46 (17%)
CARD_RIP2_CARD3 438..524 CDD:176764 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.