DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and Mlkl

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_001297542.1 Gene:Mlkl / 74568 MGIID:1921818 Length:472 Species:Mus musculus


Alignment Length:503 Identity:98/503 - (19%)
Similarity:172/503 - (34%) Gaps:156/503 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   563 RGGSDVNGKNKNNLSPLHQSIKNEDSDISLFLLEQGA-----DITALTENLDSALDLSIKHDLSE 622
            |.|:.|:|.    |.||.:            |..||.     ||||.....|..|     .:.::
Mouse    30 RLGNRVHGL----LQPLQR------------LQAQGKKNLPDDITAALGRFDEVL-----KEANQ 73

  Fly   623 VVDALCRRGIALSINKNGESPLWSALEKGYEDVAKILVRHGID---TDCWDE------------- 671
            .::...::           |.:|..:..|.:   |||. |.::   .|.|:|             
Mouse    74 QIEKFSKK-----------SHIWKFVSVGND---KILF-HEVNEKLRDVWEELLLLLQVYHWNTV 123

  Fly   672 ----GPEGCRQTLLHRAIDENKESVAIFLIQ------------SQCDLDSSRQPGPNGEGGDEAQ 720
                .|...:|.....|.::..|::.:.|:|            .||.|.      |..|...:.|
Mouse   124 SDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLK------PTQEIPQDLQ 182

  Fly   721 DKASPL-HLCCHWGQTKV--LQTLID---HGANV-----NLIDAESKSPLHVAIESQYDEIISI- 773
            .|..|. ||...|.:.|.  :.|:..   |.:.|     |...|||...:.....   |||.:: 
Mouse   183 IKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFN---DEIKTMK 244

  Fly   774 LLCHPDIDLKLR------DKSGNTP-FATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFL---- 827
            ....|:|   ||      |::...| |:..:::......:.:|||    .:.:.:..|:.|    
Mouse   245 KFDSPNI---LRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDR----EKDLTMSVRSLLVLRA 302

  Fly   828 --------HLAILKDDLESVLFLLA--IQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGA 882
                    |...|..::.|..||:|  .||.:........|:|....|.:::.|..:..:.::..
Mouse   303 ARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTAKSTKAERSSSTIYVSPE 367

  Fly   883 RMNERDAVQKLPLHI--------AIERGNLP-------AVSALIQNNADYDATDADGNNALHIAV 932
            |:.....:..:...|        .|..|.:|       .:..|:..:...:....|         
Mouse   368 RLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQD--------- 423

  Fly   933 RCAQFFIVRELLTESRV-------NAEATNLKGRNPLHELCRVVEDST 973
             |.:  ::||::.|.|.       :.:..:|.||..:.|....||:||
Mouse   424 -CPE--LLREIINECRAHEPSQRPSVDGRSLSGRERILERLSAVEEST 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125 7/31 (23%)
ANK repeat 468..501 CDD:293786
Ank_2 473..572 CDD:289560 4/8 (50%)
ANK repeat 503..539 CDD:293786
ANK 536..660 CDD:238125 21/101 (21%)
ANK repeat 541..572 CDD:293786 4/8 (50%)
ANK repeat 574..637 CDD:293786 12/67 (18%)
Ank_2 579..670 CDD:289560 18/98 (18%)
ANK repeat 639..670 CDD:293786 8/33 (24%)
Ank_2 644..752 CDD:289560 31/150 (21%)
ANK repeat 672..721 CDD:293786 11/60 (18%)
ANK 721..843 CDD:238125 32/152 (21%)
ANK repeat 723..752 CDD:293786 9/39 (23%)
ANKYR 752..977 CDD:223738 50/266 (19%)
ANK repeat 754..786 CDD:293786 9/38 (24%)
ANK 820..944 CDD:238125 24/152 (16%)
ANK repeat 822..855 CDD:293786 10/46 (22%)
ANK repeat 857..888 CDD:293786 5/30 (17%)
ANK 885..1017 CDD:238125 19/111 (17%)
ANK repeat 890..921 CDD:293786 5/45 (11%)
ANK repeat 923..955 CDD:293786 6/38 (16%)
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
MlklNP_001297542.1 N-terminal bundle and brace (NBB), mediates INSP6 binding. /evidence=ECO:0000250|UniProtKB:Q8NB16 1..143 29/148 (20%)
PHA02988 198..446 CDD:165291 47/269 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.