DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and znf1160

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_017208671.1 Gene:znf1160 / 568663 ZFINID:ZDB-GENE-050208-624 Length:397 Species:Danio rerio


Alignment Length:174 Identity:34/174 - (19%)
Similarity:63/174 - (36%) Gaps:57/174 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   943 LLTESRVNAEATNLKGRNPLHELCRVVEDSTAGLI-------CELFLESMPKYPINI-----PDM 995
            |.|..:::.::..:....|    ||:.::.|..||       .|...|...|:.:..     .:.
Zfish    14 LFTPLKLHQDSEKMSDPEP----CRIKQEETEELIDVLVKEESEALSEDERKHHVKSETETQSET 74

  Fly   996 DGNTPLLLSFMRGQSPLCKILVKAGACLGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAES 1060
            :.|.|:..:.::|     .|..:.|...  ::|..:|: :.|:.|                 .|.
Zfish    75 EDNFPVETTELKG-----FICTECGKSF--KHKYTLNV-HMKIHT-----------------GEK 114

  Fly  1061 DY-CQHCTNRFTIT--MRKH----------HCRHCG---RVLCS 1088
            .| |..|..||..:  :::|          ||..||   :.|||
Zfish   115 RYKCSQCEKRFIHSGQLKQHQRTHSREKSFHCSICGSSFKHLCS 158

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125
ANK repeat 468..501 CDD:293786
Ank_2 473..572 CDD:289560
ANK repeat 503..539 CDD:293786
ANK 536..660 CDD:238125
ANK repeat 541..572 CDD:293786
ANK repeat 574..637 CDD:293786
Ank_2 579..670 CDD:289560
ANK repeat 639..670 CDD:293786
Ank_2 644..752 CDD:289560
ANK repeat 672..721 CDD:293786
ANK 721..843 CDD:238125
ANK repeat 723..752 CDD:293786
ANKYR 752..977 CDD:223738 6/33 (18%)
ANK repeat 754..786 CDD:293786