DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and ankrd53

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_696186.2 Gene:ankrd53 / 567792 ZFINID:ZDB-GENE-141222-28 Length:246 Species:Danio rerio


Alignment Length:321 Identity:67/321 - (20%)
Similarity:97/321 - (30%) Gaps:135/321 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 GLTALHIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKNKSHDI 533
            ||:.||||||:.                  |:||                     :||       
Zfish    51 GLSVLHIAALHG------------------HLDC---------------------MEL------- 69

  Fly   534 DFNCQDINGDSPLSLCLSLKRTTLVPTLIRGG-SDVNGKNKNNLSPLH-----QSIKNEDSDISL 592
                                       |:.|| :|||....:...|||     ||..|..:.: :
Zfish    70 ---------------------------LLAGGYADVNVSCPHGRRPLHMMLTAQSQPNTHAGL-I 106

  Fly   593 FLLEQGADITALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLWSALEKGYEDVAK 657
            :|||.||.|:..|:                                .|.:||..|..:|..|..:
Zfish   107 YLLEHGAHISVSTD--------------------------------EGLTPLHQAAAEGLTDCTE 139

  Fly   658 ILVRHGIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPGPNGEGGDEAQDK 722
            .|||||.:|    ..|:....|.|..|........|.||..:....|.            |.|.|
Zfish   140 TLVRHGANT----HTPDTSGHTPLDLARIWGHRDTARFLKDAMWRKDK------------EQQMK 188

  Fly   723 ASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIESQYDEIISILLCHPDIDLK 783
            .|...   |..:.::|......|..|:::|.........|:.|.:.|::    .|...:||
Zfish   189 RSKHQ---HNLRQELLMMTKSRGKCVSVLDLPRLGRSGKAMSSPWTEVV----LHLSEELK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125 25/131 (19%)
ANK repeat 468..501 CDD:293786 9/31 (29%)
Ank_2 473..572 CDD:289560 17/99 (17%)
ANK repeat 503..539 CDD:293786 2/35 (6%)
ANK 536..660 CDD:238125 25/129 (19%)
ANK repeat 541..572 CDD:293786 6/31 (19%)
ANK repeat 574..637 CDD:293786 13/67 (19%)
Ank_2 579..670 CDD:289560 24/95 (25%)
ANK repeat 639..670 CDD:293786 12/30 (40%)
Ank_2 644..752 CDD:289560 26/107 (24%)
ANK repeat 672..721 CDD:293786 9/48 (19%)
ANK 721..843 CDD:238125 13/63 (21%)
ANK repeat 723..752 CDD:293786 5/28 (18%)
ANKYR 752..977 CDD:223738 7/32 (22%)
ANK repeat 754..786 CDD:293786 6/30 (20%)
ANK 820..944 CDD:238125
ANK repeat 822..855 CDD:293786
ANK repeat 857..888 CDD:293786
ANK 885..1017 CDD:238125
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
ankrd53XP_696186.2 Ank_4 22..71 CDD:290365 13/92 (14%)
ANK 46..174 CDD:238125 49/232 (21%)
ANK repeat 50..82 CDD:293786 19/103 (18%)
Ank_2 55..152 CDD:289560 42/206 (20%)
ANK repeat 84..119 CDD:293786 12/35 (34%)
ANK repeat 121..152 CDD:293786 12/34 (35%)
Ank_2 126..>184 CDD:289560 18/73 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115202at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.