DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and MAP3K20

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_057737.2 Gene:MAP3K20 / 51776 HGNCID:17797 Length:800 Species:Homo sapiens


Alignment Length:498 Identity:107/498 - (21%)
Similarity:178/498 - (35%) Gaps:181/498 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 LLGICERALVTSV-GVRSCIRFY----------CVAEEVGASTLLEYCSSIISTHWD-----DLT 203
            ||.|.:.|.:.|| ..|:.|:||          .|.|.....:|.:|.:|..|...|     ...
Human    47 LLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWA 111

  Fly   204 TD-----DFQHMSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLC---IQKYGN-----SLVNTF- 254
            ||     .:.||..|:.......|:::.:.||     :.|:.:|   ..::.|     |||.|| 
Human   112 TDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAA-----DGVLKICDFGASRFHNHTTHMSLVGTFP 171

  Fly   255 ------------SEN------GILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALK 301
                        ||.      |::..||        :.:.:...|        :||..:....::
Human   172 WMAPEVIQSLPVSETCDTYSYGVVLWEM--------LTREVPFKG--------LEGLQVAWLVVE 220

  Fly   302 NGDAFS------ANF--LLDQNCLLDLPSKP------------SSDTALHIICNYGPDNTPE--- 343
            ..:..:      .:|  ||.|....|...:|            |:||:|...||....|..|   
Human   221 KNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRC 285

  Fly   344 ----IMEVVKKILQRQLNINIQNIKGETPLHIAIARRNVEMVKLLLK-------VPNIDINLRTY 397
                .:|.:|| |:|.|:...|.:|..        .|.::|.:..|.       :|:.:|...|.
Human   286 EIEATLERLKK-LERDLSFKEQELKER--------ERRLKMWEQKLTEQSNTPLLPSFEIGAWTE 341

  Fly   398 DE-KCALELSLSMGDHEFLIASILLSMGARTDRTNSKTGDSLLQVFALDR------HRGE----K 451
            |: .|.::..:..||     :|..:|:.|...:.|:.||..||.:...|.      .:|.    |
Human   342 DDVYCWVQQLVRKGD-----SSAEMSVYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFK 401

  Fly   452 SAIFLADFADLDHINFRGLTALHIAALNNMPNLVK-----------KLIVNGASSNLK-----HI 500
            |||   :....|:||           |.:.|.|:|           |::      ||:     |:
Human   402 SAI---EKLTHDYIN-----------LFHFPPLIKDSGGEPEENEEKIV------NLELVFGFHL 446

  Fly   501 -------DCGLKSALHIAVEANAIDALEAFVELKNKSHDIDFN 536
                   ||  |..:::.::.:.|    |...:|    |:.||
Human   447 KPGTGPQDC--KWKMYMEMDGDEI----AITYIK----DVTFN 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045 4/8 (50%)
BTB 75..166 CDD:197585 4/10 (40%)
ANK 252..385 CDD:238125 34/178 (19%)
ANK repeat 291..322 CDD:293786 7/38 (18%)
ANK repeat 325..362 CDD:293786 14/43 (33%)
Ank_2 330..431 CDD:289560 26/115 (23%)
ANK 463..595 CDD:238125 20/97 (21%)
ANK repeat 468..501 CDD:293786 8/55 (15%)
Ank_2 473..572 CDD:289560 17/87 (20%)
ANK repeat 503..539 CDD:293786 7/34 (21%)
ANK 536..660 CDD:238125 1/1 (100%)
ANK repeat 541..572 CDD:293786
ANK repeat 574..637 CDD:293786
Ank_2 579..670 CDD:289560
ANK repeat 639..670 CDD:293786
Ank_2 644..752 CDD:289560
ANK repeat 672..721 CDD:293786
ANK 721..843 CDD:238125
ANK repeat 723..752 CDD:293786
ANKYR 752..977 CDD:223738
ANK repeat 754..786 CDD:293786
ANK 820..944 CDD:238125
ANK repeat 822..855 CDD:293786
ANK repeat 857..888 CDD:293786
ANK 885..1017 CDD:238125
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
MAP3K20NP_057737.2 STKc_MLTK 22..263 CDD:270962 47/236 (20%)
STYKc 23..260 CDD:214568 47/233 (20%)
Leucine-zipper 287..308 7/21 (33%)
SAM_MLTK 338..408 CDD:188928 19/77 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 652..800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.