DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG41099 and LOC405768

DIOPT Version :9

Sequence 1:	NP_001015359.1	Gene:	CG41099 / 3355072	FlyBaseID:	FBgn0039955	Length:	1124	Species:	Drosophila melanogaster
Sequence 2:	NP_001353900.1	Gene:	LOC405768 / 405768	-ID:	-	Length:	477	Species:	Danio rerio

Alignment Length:	192	Identity:	37/192 - (19%)
Similarity:	60/192 - (31%)	Gaps:	75/192 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly    97 EKWGNDLLSNIQQLDWSDLNEDVVLSLLRWIYTDLIDLQNDGLALDLLKAAHRFGLPSLLGICER 161
            |..|.....::.:..|...:::|.:..|              |.:|                .|.
Zfish    51 ENCGGGSFGSVYRAHWVPQDKEVAVKKL--------------LKID----------------AEA 85

  Fly   162 ALVTSVGVRSCIRFY----------CVAEEVGASTLLEYCSSIISTHWDDLTTDDFQHMSGPLLF 216
            .:::.:..::.|:||          .|.|.....:|.||.||..|...|         |...:.:
Zfish    86 EILSVLSHKNIIQFYGAILEAPNYGIVTEYASRGSLYEYLSSADSEEMD---------MDQVMTW 141

  Fly   217 EMLKTKTKHPLHAA--------------VRLLREDVVSLCIQKYG----------NSLVNTF 254
            .|...|..|.|||.              |.|..::|:.:|  .:|          .|||.||
Zfish   142 AMEIAKGMHYLHAEAPLKVIHRDLKSRNVVLTADNVLKIC--DFGASKMVSHTTHMSLVGTF 201

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG41099	NP_001015359.1	BTB	67..164	CDD:279045	8/66 (12%)
		BTB	75..166	CDD:197585	8/68 (12%)
		ANK	252..385	CDD:238125	2/3 (67%)
		ANK repeat	291..322	CDD:293786
		ANK repeat	325..362	CDD:293786
		Ank_2	330..431	CDD:289560
		ANK	463..595	CDD:238125
		ANK repeat	468..501	CDD:293786
		Ank_2	473..572	CDD:289560
		ANK repeat	503..539	CDD:293786
		ANK	536..660	CDD:238125
		ANK repeat	541..572	CDD:293786
		ANK repeat	574..637	CDD:293786
		Ank_2	579..670	CDD:289560
		ANK repeat	639..670	CDD:293786
		Ank_2	644..752	CDD:289560
		ANK repeat	672..721	CDD:293786
		ANK	721..843	CDD:238125
		ANK repeat	723..752	CDD:293786
		ANKYR	752..977	CDD:223738
		ANK repeat	754..786	CDD:293786
		ANK	820..944	CDD:238125
		ANK repeat	822..855	CDD:293786
		ANK repeat	857..888	CDD:293786
		ANK	885..1017	CDD:238125
		ANK repeat	890..921	CDD:293786
		ANK repeat	923..955	CDD:293786
		ANK repeat	996..1021	CDD:293786
		FYVE_ANFY1	1054..1116	CDD:277267
LOC405768	NP_001353900.1	STKc_MLTK	53..294	CDD:270962	36/190 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0192
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900