DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and dstyk

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_005168327.1 Gene:dstyk / 402922 ZFINID:ZDB-GENE-040826-2 Length:885 Species:Danio rerio


Alignment Length:808 Identity:153/808 - (18%)
Similarity:258/808 - (31%) Gaps:303/808 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LLEYCSSIISTHWDDLTTDD--FQHMSGPL--LFEMLKTKTKHPLHAAVRLLREDVVSLC--IQK 245
            |..:|.     .||.:...|  .|....|.  |.| |:....|.|...|:::    |..|  :|.
Zfish   146 LAAHCG-----RWDTVPRQDLEIQECEDPAQRLAE-LEITLHHTLLQEVKIM----VLPCRNVQP 200

  Fly   246 YGNSLVNTFSENGILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSAL-------KNG 303
            ...:|.:  .:.||||:.:...|:.             :::|..:|....|:.:|       :..
Zfish   201 LEEALED--CKRGILPIVLYAVSRE-------------SLSAQQLEDLQTLRESLPFPVCFIRVS 250

  Fly   304 DAFSANFLLDQ------------NCLLDLPSKPSSDTALHIICNYGPDNTPEIMEVV----KKIL 352
            |......|..|            ||....|:..|:.....::|    |:...:..|:    :::|
Zfish   251 DGGGGGALFTQLASLQLISASAGNCACGAPAAQSAGRMQGVLC----DSLERLQRVLVPFTRQVL 311

  Fly   353 QRQLNINIQNIKGETPLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMGDHEFLIA 417
            |.|                     .||...|          |.|...:| |:|        |:|.
Zfish   312 QNQ---------------------QVEAATL----------LNTIHCRC-LDL--------FIIQ 336

  Fly   418 SI-----LLSMGARTDRTNSKTGDSLLQVFALDRHRGEKSAIFLAD---------FADLDHINFR 468
            :.     |.....|.:.|..|.|:....:.|:...:.|:....:.:         ..|..:::|.
Zfish   337 AFDMQRDLQITPRRLEYTREKEGELFCSLMAIANRKQEEMKEMIVETLSSMKEQLLEDAQNLDFT 401

  Fly   469 GLTALHIAALNNMP----------NLVKKLIVNGASSNLKHIDCGLKSALHIAVE---ANAIDAL 520
            .:    |.:.|..|          :.::.||||               .|:.||.   .|::|.|
Zfish   402 DI----IMSSNGEPVSSKDIKVCISQIQDLIVN---------------RLNQAVANKLTNSVDYL 447

  Fly   521 -EAFVELKNKSHDIDFNCQDINGDSPLSLCL-SLKRTTLVPTLIRGGSDVNGKNKNNLSPL---- 579
             |:||                   ..|..|| ||:::|  |.     |..:....|:|..:    
Zfish   448 RESFV-------------------GTLERCLGSLEKST--PE-----SCAHNVTSNHLKQILNAA 486

  Fly   580 -HQSIK-NEDSDISLFLLEQGADIT-ALTENLDSALDLSIKHDLS-EVVDALCRRGIALSINKNG 640
             |..:. :..|.::....||...|. .:|.....|:....|..:: :.:::|....:|.||....
Zfish   487 YHVEVTFHSGSSVTRLFWEQIKQIIHRITWVNPPAITAEWKRKVAQDAIESLSAAKLAKSICSQF 551

  Fly   641 ESPLWSA----------LEKGY---------------EDVAKILVRHGIDTDCWDEGPEGCRQTL 680
            .:.|.|:          ||:|:               :|.|..|.|..:::       ...|..|
Zfish   552 RTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLES-------RSLRDIL 609

  Fly   681 LH------RAIDENKESVAIFLIQS-----QCDLDSSRQPGPNGEGGDEAQDKASPLHLCCHWGQ 734
            ||      |.:...:..| ::|..|     .|.|.|...|          .||        ||..
Zfish   610 LHGKPKLGRELGRGQYGV-VYLCDSWAGRHPCALKSVVPP----------DDK--------HWND 655

  Fly   735 TKV----LQTLIDHGANVNLIDAESKSPLHVAIESQYD--EIISILL----CHPDI------DLK 783
            ..:    .::|..|...|||..:        .|:..|.  ..|::||    .|.|:      .|.
Zfish   656 LALEFHYTRSLPKHERLVNLHGS--------VIDHSYSGGSSIAVLLIMERLHRDLYTGLKAGLS 712

  Fly   784 LRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFLH-LAILKDDLESVLFLLAIQ- 846
            |:::     ...|||.                     :.|..||| ..:|..|::....||..| 
Zfish   713 LKER-----LLIALDV---------------------VEGIRFLHSQGLLHRDIKLKNVLLDKQN 751

  Fly   847 ----VDVNSRVHDANQS-----SPLHLA 865
                .|:.....:|..|     :|:|:|
Zfish   752 RAKITDLGFCKPEAMMSGSIVGTPIHMA 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125 25/155 (16%)
ANK repeat 291..322 CDD:293786 8/49 (16%)
ANK repeat 325..362 CDD:293786 7/40 (18%)
Ank_2 330..431 CDD:289560 18/109 (17%)
ANK 463..595 CDD:238125 29/152 (19%)
ANK repeat 468..501 CDD:293786 7/42 (17%)
Ank_2 473..572 CDD:289560 24/113 (21%)
ANK repeat 503..539 CDD:293786 9/39 (23%)
ANK 536..660 CDD:238125 29/157 (18%)
ANK repeat 541..572 CDD:293786 8/31 (26%)
ANK repeat 574..637 CDD:293786 13/70 (19%)
Ank_2 579..670 CDD:289560 21/123 (17%)
ANK repeat 639..670 CDD:293786 9/55 (16%)
Ank_2 644..752 CDD:289560 30/147 (20%)
ANK repeat 672..721 CDD:293786 12/59 (20%)
ANK 721..843 CDD:238125 27/138 (20%)
ANK repeat 723..752 CDD:293786 7/32 (22%)
ANKYR 752..977 CDD:223738 27/137 (20%)
ANK repeat 754..786 CDD:293786 9/43 (21%)
ANK 820..944 CDD:238125 15/57 (26%)
ANK repeat 822..855 CDD:293786 10/38 (26%)
ANK repeat 857..888 CDD:293786 4/14 (29%)
ANK 885..1017 CDD:238125
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
dstykXP_005168327.1 PKc_Dusty 613..874 CDD:270877 44/220 (20%)
S_TKc 615..859 CDD:214567 44/218 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.