DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and Mos

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster


Alignment Length:356 Identity:67/356 - (18%)
Similarity:116/356 - (32%) Gaps:88/356 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 HRGEKSAIFLADFADLDHINF---RGLTALHIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSAL 508
            ||.....:.|...||...:..   ||.:...|.....:|.:.:.||.....:.|::  |..::.|
  Fly    70 HRNIVRLLKLESAADFGLVIMECPRGQSLQRIVDTLALPLMHRVLITLDVVAALRY--CHSQNVL 132

  Fly   509 HIAVEANAIDALEAFVELKNKSHDIDFNCQDINGDSPLSLCLSLKRTTLVPTLIRGGSDVNGK-- 571
            |:.|:...|     .|.|..||   ...|.        |..:.:||:.:......|.|...|:  
  Fly   133 HLDVKPTNI-----LVALGTKS---SITCN--------SSKIKVKRSYICKLCDFGSSIEMGEFC 181

  Fly   572 -------NKNNLSPLHQSIKNEDSDISLFLLEQGADITALTENLDSALDLSIKHDLSEVVDALCR 629
                   .|..|..:.......|:      |.:.:||.:|...:   ..|..:......:|  |.
  Fly   182 AWQEPSVAKGTLRYMSPEALRSDT------LTEASDIYSLGITM---WQLQARRLPYHTLD--CN 235

  Fly   630 RGIALSINKNGESPLWSALEKGYEDVAKILVRHGIDTDCWDEGPEGCRQTLLHRAIDENKESVAI 694
            ..||..:.|:...|      ..|..:..:.:...||.| ||...|.....:..||....:.::::
  Fly   236 ETIAYQVVKHELRP------DNYHQLKILALDSPIDCD-WDLAHESTANVICRRANTSARRNLSL 293

  Fly   695 ---FLIQSQCDLDSSR----------QPGPNGEGGDEAQDKASPLHLCCHWGQTKVLQTLIDHGA 746
               :.:..  ||...|          .|.|.|....|:  ..|.|:..| |.....|:.      
  Fly   294 DPSYTVGR--DLKKKRHRNRLALHFDSPAPEGSACSES--AYSQLYKSC-WVSAPELRL------ 347

  Fly   747 NVNLIDAESKSPLHVAIESQYDEIISILLCH 777
                          .:|:.:::  :..:|||
  Fly   348 --------------SSIQLKHE--LEFILCH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125 26/143 (18%)
ANK repeat 468..501 CDD:293786 7/32 (22%)
Ank_2 473..572 CDD:289560 21/107 (20%)
ANK repeat 503..539 CDD:293786 9/35 (26%)
ANK 536..660 CDD:238125 22/132 (17%)
ANK repeat 541..572 CDD:293786 6/39 (15%)
ANK repeat 574..637 CDD:293786 11/62 (18%)
Ank_2 579..670 CDD:289560 16/90 (18%)
ANK repeat 639..670 CDD:293786 5/30 (17%)
Ank_2 644..752 CDD:289560 21/120 (18%)
ANK repeat 672..721 CDD:293786 10/61 (16%)
ANK 721..843 CDD:238125 9/57 (16%)
ANK repeat 723..752 CDD:293786 5/28 (18%)
ANKYR 752..977 CDD:223738 4/26 (15%)
ANK repeat 754..786 CDD:293786 4/24 (17%)
ANK 820..944 CDD:238125
ANK repeat 822..855 CDD:293786
ANK repeat 857..888 CDD:293786
ANK 885..1017 CDD:238125
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 51/263 (19%)
S_TKc 26..257 CDD:214567 43/221 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.