DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and Ripk2

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_001178794.1 Gene:Ripk2 / 362491 RGDID:1309167 Length:539 Species:Rattus norvegicus


Alignment Length:405 Identity:78/405 - (19%)
Similarity:145/405 - (35%) Gaps:119/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PAHKIV-LHARSEKWGNDLLSNIQQLDWSDLNEDVVLSLLRWIYTDLIDLQNDGLALD---LLKA 146
            |.||:. ||..| :..:..:|:.:..||   ...|.:..|. |:|.|:|.:.:.:..:   |.||
  Rat    14 PYHKLADLHYLS-RGASGTVSSARHADW---RVRVAVKHLH-IHTPLLDSERNDILREAEILHKA 73

  Fly   147 AHRFGLPSLLGICERALVTSVGVRSCIRFYCVAEEVGASTLLEYCSSIISTHWDDLTTDDFQHMS 211
            ...:.|| :||||..                 .|.:|..|                     ::|.
  Rat    74 RFSYILP-ILGICNE-----------------PEFLGIVT---------------------EYMP 99

  Fly   212 GPLLFEMLKTKTKHPLHA---AVRLLREDVVSLCIQKYGNSLVNTFSENGILPLEMALSSKNAKI 273
            ...|.|:|..||::|..|   ..|:|.|..:.:      |.|.|         :...|...:.|.
  Rat   100 NGSLNELLHRKTEYPEIAWPLRFRILHEIALGV------NYLHN---------MNPPLLHHDLKT 149

  Fly   274 AKSLVDN---------GMANINAVNMEGFSLLKSALKNGDAFSANFLLDQNCLLDLPSKPSSDTA 329
            ...|:||         |::....:::......|||.:.|...   ::..:|.   .|.:.|..:.
  Rat   150 QNILLDNEFHVKIADFGLSKWRMMSLSQSRSYKSAPEGGTII---YMPPENY---EPGQKSRASV 208

  Fly   330 LHIICNYGP------------DNTPEIMEVVKKILQ-RQLNINIQNIKGETP---LHIAIAR--- 375
            .|.|.:|..            :.....::::..:.| .:.|.:.:|:..:.|   |.|::.:   
  Rat   209 KHDIYSYAVIMWEVLSRKQPFEEVTNPLQIMYSVSQGHRPNTSEENLPFDIPHRGLMISLIQSGW 273

  Fly   376 -----RNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMGDHEFLIAS-----------ILLSMG 424
                 .....:|.|:::..:   |||:::...||..:.:...:...||           :.|::.
  Rat   274 AQNPDERPSFLKCLIELEPV---LRTFEDITFLEAVIQLKKSKIQSASSTIHLCDKKMDLSLNIP 335

  Fly   425 ARTDRTNSKTGDSLL 439
            |.........|.|||
  Rat   336 ASHPPQEESCGSSLL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045 24/81 (30%)
BTB 75..166 CDD:197585 24/83 (29%)
ANK 252..385 CDD:238125 24/165 (15%)
ANK repeat 291..322 CDD:293786 5/30 (17%)
ANK repeat 325..362 CDD:293786 6/49 (12%)
Ank_2 330..431 CDD:289560 20/135 (15%)
ANK 463..595 CDD:238125
ANK repeat 468..501 CDD:293786
Ank_2 473..572 CDD:289560
ANK repeat 503..539 CDD:293786
ANK 536..660 CDD:238125
ANK repeat 541..572 CDD:293786
ANK repeat 574..637 CDD:293786
Ank_2 579..670 CDD:289560
ANK repeat 639..670 CDD:293786
Ank_2 644..752 CDD:289560
ANK repeat 672..721 CDD:293786
ANK 721..843 CDD:238125
ANK repeat 723..752 CDD:293786
ANKYR 752..977 CDD:223738
ANK repeat 754..786 CDD:293786
ANK 820..944 CDD:238125
ANK repeat 822..855 CDD:293786
ANK repeat 857..888 CDD:293786
ANK 885..1017 CDD:238125
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
Ripk2NP_001178794.1 STKc_RIP2 20..303 CDD:270928 65/350 (19%)
STYKc 21..290 CDD:214568 62/333 (19%)
CARD_RIP2_CARD3 437..523 CDD:176764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.