DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and ANKRD42

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_001287904.1 Gene:ANKRD42 / 338699 HGNCID:26752 Length:527 Species:Homo sapiens


Alignment Length:404 Identity:86/404 - (21%)
Similarity:140/404 - (34%) Gaps:127/404 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 ADLDHINFRGLTALHIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFV 524
            ||:.|:..||.||.||||:......|:.||:|||                               
Human    84 ADITHVTTRGWTASHIAAIRGQDACVQALIMNGA------------------------------- 117

  Fly   525 ELKNKSHDIDFNCQDINGDSPLSLCLSLKRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKNEDSD 589
                     :...||..|.:||.|..:...:..:..::|.|.|.:..:|....|:|.:..:....
Human   118 ---------NLTAQDDRGCTPLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLG 173

  Fly   590 ISLFLLEQGADITALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLWSALEKGYED 654
            ....|::.|..|    |::|                            .||..|:..|..:|:..
Human   174 CLQLLVKWGCSI----EDVD----------------------------YNGNLPVHLAAMEGHLH 206

  Fly   655 VAKILVRHGIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQ----------P 709
            ..|.||..          .....|.|  :|.::|.|:|          ||.:::          .
Human   207 CFKFLVSR----------MSSATQVL--KAFNDNGENV----------LDLAQRFFKQNILQFIQ 249

  Fly   710 GPNGEGGD--EAQDKASPLHLCCHWGQTKVLQTLIDHGA-NVNLIDAESKSPLHVAIESQYDEII 771
            |...||.|  :.:..|.|.|:....|...:|:.|::.|. |:|.......:|:|.|....:.|.:
Human   250 GAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECL 314

  Fly   772 SILLCHPDIDLKLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRN---------FL 827
            ..|: ....|..:.:|:|..|...|..|. |.||.::|:..    ::.||...|         |:
Human   315 QWLI-KMGADSNITNKAGERPSDVAKRFA-HLAAVKLLEEL----QKYDIDDENEIDENDVKYFI 373

  Fly   828 HLAI-----LKDDL 836
            ...:     .||||
Human   374 RHGVEGSTDAKDDL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125 27/131 (21%)
ANK repeat 468..501 CDD:293786 14/32 (44%)
Ank_2 473..572 CDD:289560 19/98 (19%)
ANK repeat 503..539 CDD:293786 0/35 (0%)
ANK 536..660 CDD:238125 23/123 (19%)
ANK repeat 541..572 CDD:293786 7/30 (23%)
ANK repeat 574..637 CDD:293786 7/62 (11%)
Ank_2 579..670 CDD:289560 14/90 (16%)
ANK repeat 639..670 CDD:293786 8/30 (27%)
Ank_2 644..752 CDD:289560 26/120 (22%)
ANK repeat 672..721 CDD:293786 12/60 (20%)
ANK 721..843 CDD:238125 32/131 (24%)
ANK repeat 723..752 CDD:293786 9/29 (31%)
ANKYR 752..977 CDD:223738 23/99 (23%)
ANK repeat 754..786 CDD:293786 6/31 (19%)
ANK 820..944 CDD:238125 8/31 (26%)
ANK repeat 822..855 CDD:293786 6/29 (21%)
ANK repeat 857..888 CDD:293786
ANK 885..1017 CDD:238125
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
ANKRD42NP_001287904.1 ANK <17..80 CDD:238125
Ank_4 26..80 CDD:290365
ANK repeat 30..56 CDD:293786
ANK 59..179 CDD:238125 29/134 (22%)
ANK repeat 59..90 CDD:293786 3/5 (60%)
Ank_2 64..156 CDD:289560 26/111 (23%)
ANK repeat 92..123 CDD:293786 14/70 (20%)
ANKYR 94..375 CDD:223738 77/380 (20%)
ANK 121..248 CDD:238125 33/180 (18%)
ANK repeat 125..156 CDD:293786 7/30 (23%)
ANK repeat 158..189 CDD:293786 6/34 (18%)
ANK 188..350 CDD:238125 44/213 (21%)
ANK repeat 297..328 CDD:293786 6/31 (19%)
Prefoldin <394..482 CDD:298833
HalX <430..472 CDD:285826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115202at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.