Sequence 1: | NP_001015359.1 | Gene: | CG41099 / 3355072 | FlyBaseID: | FBgn0039955 | Length: | 1124 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608901.1 | Gene: | CG9121 / 33732 | FlyBaseID: | FBgn0031675 | Length: | 600 | Species: | Drosophila melanogaster |
Alignment Length: | 301 | Identity: | 72/301 - (23%) |
---|---|---|---|
Similarity: | 140/301 - (46%) | Gaps: | 63/301 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 454 IFLADFADLDHINFRGLTALHIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAID 518
Fly 519 ALEAFVELKNKSHDIDFNCQDINGDSPLSLCLSLKRTTLVPTLIRGGSDVNGKNKNNLSPLHQSI 583
Fly 584 KNEDSDISLFLLEQGADITALTENLDSALDLSIKHDLSEVVDALCRRGIALSI-NKNGESPLWSA 647
Fly 648 LEKGYEDVAKILV-------RHGIDTDCWDEG--------------------------P------ 673
Fly 674 -EGCRQTL----------LHRAIDENKESVAIFLIQSQCDL 703 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG41099 | NP_001015359.1 | BTB | 67..164 | CDD:279045 | |
BTB | 75..166 | CDD:197585 | |||
ANK | 252..385 | CDD:238125 | |||
ANK repeat | 291..322 | CDD:293786 | |||
ANK repeat | 325..362 | CDD:293786 | |||
Ank_2 | 330..431 | CDD:289560 | |||
ANK | 463..595 | CDD:238125 | 30/131 (23%) | ||
ANK repeat | 468..501 | CDD:293786 | 10/32 (31%) | ||
Ank_2 | 473..572 | CDD:289560 | 25/98 (26%) | ||
ANK repeat | 503..539 | CDD:293786 | 9/35 (26%) | ||
ANK | 536..660 | CDD:238125 | 30/124 (24%) | ||
ANK repeat | 541..572 | CDD:293786 | 6/30 (20%) | ||
ANK repeat | 574..637 | CDD:293786 | 17/63 (27%) | ||
Ank_2 | 579..670 | CDD:289560 | 23/98 (23%) | ||
ANK repeat | 639..670 | CDD:293786 | 6/37 (16%) | ||
Ank_2 | 644..752 | CDD:289560 | 22/110 (20%) | ||
ANK repeat | 672..721 | CDD:293786 | 15/75 (20%) | ||
ANK | 721..843 | CDD:238125 | |||
ANK repeat | 723..752 | CDD:293786 | |||
ANKYR | 752..977 | CDD:223738 | |||
ANK repeat | 754..786 | CDD:293786 | |||
ANK | 820..944 | CDD:238125 | |||
ANK repeat | 822..855 | CDD:293786 | |||
ANK repeat | 857..888 | CDD:293786 | |||
ANK | 885..1017 | CDD:238125 | |||
ANK repeat | 890..921 | CDD:293786 | |||
ANK repeat | 923..955 | CDD:293786 | |||
ANK repeat | 996..1021 | CDD:293786 | |||
FYVE_ANFY1 | 1054..1116 | CDD:277267 | |||
CG9121 | NP_608901.1 | ANK | 151..300 | CDD:238125 | 33/140 (24%) |
ANK repeat | 151..179 | CDD:293786 | 3/11 (27%) | ||
Ank_2 | 153..244 | CDD:289560 | 23/84 (27%) | ||
ANK repeat | 181..210 | CDD:293786 | 9/30 (30%) | ||
ANK repeat | 213..244 | CDD:293786 | 9/36 (25%) | ||
Ank_2 | 218..304 | CDD:289560 | 19/90 (21%) | ||
ANK | 241..362 | CDD:238125 | 30/124 (24%) | ||
ANK repeat | 246..277 | CDD:293786 | 6/30 (20%) | ||
ANK repeat | 279..304 | CDD:293786 | 5/24 (21%) | ||
Ank_4 | 311..362 | CDD:290365 | 13/53 (25%) | ||
SOCS_box | 518..574 | CDD:284857 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24198 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |