DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and Hrs

DIOPT Version :10

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_525099.3 Gene:Hrs / 33458 FlyBaseID:FBgn0031450 Length:760 Species:Drosophila melanogaster


Alignment Length:176 Identity:56/176 - (31%)
Similarity:72/176 - (40%) Gaps:41/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   961 PLHELCRVVEDSTAGLICEL---FLESMPKYPINIPDMDGNTPLLLSFMRGQSPLCKILVKAGAC 1022
            |:||.....|:      ||:   ||||.|...:.                 |..|..:...|.|.
  Fly    76 PVHEEVFTKEN------CEMFSSFLESTPHENVR-----------------QKMLELVQTWAYAF 117

  Fly  1023 LGTEN----KDGINIFNFKLATDQLLHN-----LLDQLPQESPWAESDYCQHCTNRFTITMRKHH 1078
            ..::.    ||.:.|...|..|...|..     ..|..|.   ||:...|..|...||.|.||||
  Fly   118 RSSDKYQAIKDTMTILKAKGHTFPELREADAMFTADTAPN---WADGRVCHRCRVEFTFTNRKHH 179

  Fly  1079 CRHCGRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQ---CGNG 1121
            ||:||:|.|.:|:....|:.|:||.|.||||..||..||   .|:|
  Fly   180 CRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAALQRPTSGSG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB_POZ_Rank-5 63..174 CDD:349612
BACK_ANKFY1_Rank5 167..255 CDD:350576
PHA03100 <243..>392 CDD:476869
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
ANKYR 383..671 CDD:440430
ANK repeat 468..501 CDD:293786
ANK repeat 503..539 CDD:293786
ANK repeat 541..572 CDD:293786
ANK repeat 574..637 CDD:293786
ANK repeat 639..670 CDD:293786
Ank_2 644..752 CDD:463710
ANK repeat 672..721 CDD:293786
ANK repeat 723..752 CDD:293786
ANKYR 741..1034 CDD:440430 17/79 (22%)
ANK repeat 754..786 CDD:293786
ANK repeat 822..855 CDD:293786
ANK repeat 857..888 CDD:293786
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786 3/24 (13%)
FYVE_ANFY1 1054..1116 CDD:277267 29/61 (48%)
HrsNP_525099.3 VHS_Hrs 4..141 CDD:340771 20/87 (23%)
FYVE_Hrs 157..217 CDD:277260 29/62 (47%)
GAT_Hrs 376..471 CDD:410592
PABP-1234 <501..641 CDD:130689
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.