DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and CG8173

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster


Alignment Length:423 Identity:91/423 - (21%)
Similarity:147/423 - (34%) Gaps:135/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 LDLPSKPSSDTALH--IICNYGPDNTPEIMEV-----VKKILQRQLNINIQNIKGETPLHIA-IA 374
            :::|..|...|..|  .|..|..|.:|.:.|:     ||:|.| .:.:....:..|..:|.| |.
  Fly    23 INVPPSPMMKTLGHGTGIRVYRLDRSPRLGEIRSPWAVKRITQ-NMRVKKDTLFNERIVHEADIL 86

  Fly   375 RRNVEMVKLLLKVPNIDINLR---TYDE---KCALEL-SLSMGD----------------HEF-L 415
            |:        ||.||| :..|   |.||   ..|||: :.|:|.                |.: :
  Fly    87 RK--------LKHPNI-VGFRGVITNDEGINTLALEMCTTSLGSILEERHDEDLGPLPAKHTYKM 142

  Fly   416 IASILLSMGARTDRTNSKTGDSLLQVFALDRHRGEKSAIFLADFA---DLD---HINFRGLTALH 474
            |..:..::....:..:...||  |:.|.: ..:||.....|.||.   .||   .:||.....|.
  Fly   143 IMDVAQALDFLHNEAHLMHGD--LKSFNV-LVKGEFEICKLCDFGVSLPLDEQGEVNFLKNPGLR 204

  Fly   475 IAALN--NMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKNKSHDI---- 533
            ....|  ..|.::.::.|..:.:::......:...|.: |..:.::...|..|..:.|||:    
  Fly   205 YVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYETLAL-VPPHTLELDAALGEDMDSSHDLPTDT 268

  Fly   534 -DFNCQDINGDSPLSLCLSLKRTTLVPTLIRGGSDVNGKNKNNL---------SPLHQSIKNED- 587
             ...|:.::..|                         .:|||.|         :.:.|....|| 
  Fly   269 DKLQCKQLDFSS-------------------------DENKNGLPSAMEEHTDNDMSQDYDEEDD 308

  Fly   588 -------------------SDISLFLLEQGADITALTENLDSAL----DLSIKHDLSE----VVD 625
                               :|||.|.|          .||.||.    .|.:...||:    ||:
  Fly   309 EEEKEEEEEDDEEDDDTKENDISYFTL----------NNLHSAYGTRPPLPVAFQLSDDYNCVVE 363

  Fly   626 A--LCRRGIALSINKNGESPLWSALEKGYEDVA 656
            .  ||..  |||.::.....:|..||....:||
  Fly   364 LFYLCTN--ALSEDRPAAKTIWQCLENNGANVA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125 18/74 (24%)
ANK repeat 291..322 CDD:293786 0/3 (0%)
ANK repeat 325..362 CDD:293786 11/43 (26%)
Ank_2 330..431 CDD:289560 31/132 (23%)
ANK 463..595 CDD:238125 27/170 (16%)
ANK repeat 468..501 CDD:293786 4/34 (12%)
Ank_2 473..572 CDD:289560 13/105 (12%)
ANK repeat 503..539 CDD:293786 8/40 (20%)
ANK 536..660 CDD:238125 33/160 (21%)
ANK repeat 541..572 CDD:293786 1/30 (3%)
ANK repeat 574..637 CDD:293786 24/101 (24%)
Ank_2 579..670 CDD:289560 27/108 (25%)
ANK repeat 639..670 CDD:293786 5/18 (28%)
Ank_2 644..752 CDD:289560 5/13 (38%)
ANK repeat 672..721 CDD:293786
ANK 721..843 CDD:238125
ANK repeat 723..752 CDD:293786
ANKYR 752..977 CDD:223738
ANK repeat 754..786 CDD:293786
ANK 820..944 CDD:238125
ANK repeat 822..855 CDD:293786
ANK repeat 857..888 CDD:293786
ANK 885..1017 CDD:238125
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 88/411 (21%)
S_TKc 30..>245 CDD:214567 51/228 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.