DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and Ankrd42

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_017444434.1 Gene:Ankrd42 / 293117 RGDID:1310789 Length:522 Species:Rattus norvegicus


Alignment Length:467 Identity:103/467 - (22%)
Similarity:172/467 - (36%) Gaps:131/467 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   672 GP-EGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPGPNG------EGGD------------ 717
            || :.||:|                     .|...||...|.|      ..||            
  Rat    13 GPSKSCRET---------------------ADSIGSRNKVPFGSIHDAVRAGDVKQLSDIVERGA 56

  Fly   718 -----EAQDKASPLHL--------CCHW-------------------------GQTKVLQTLIDH 744
                 :|..:.:|||.        |.||                         ||...||.||.:
  Rat    57 NVNEVDALHQFTPLHWAAHSGSLECLHWLLWNGADATQTTTRGWTAAHVAAIRGQDACLQALIIN 121

  Fly   745 GANVNLIDAESKSPLHVAIESQYDEIISILLCHPDIDLKLRDKSGNTPFATALDFRNHNAAQRIL 809
            |||:...|....:|:|:|....:...:.::| ...:|..:.||....|...|. |.......::|
  Rat   122 GANLATQDDRGCTPVHLAATHGHSFSLQVML-RSGVDPSVTDKREWRPVHYAA-FHGRLGCLQLL 184

  Fly   810 DRFPTAAEQMDIRGRNFLHLAILKDDLESVLFLLAIQVDVNSRVH-----DANQSSPLHLAAASQ 869
            .::....|.:|..|...:|||.::..|....|||:   .|||.|.     :.|..:.|.||    
  Rat   185 VKWGCGIEDVDYNGNLPVHLAAMEGHLHCFKFLLS---RVNSAVQALKAFNDNGENVLDLA---- 242

  Fly   870 NEMITRNLI-------LAGARMNERDAVQKLPLHIAIERGNLPAVSALIQNNA-DYDATDADGNN 926
            :..:.:|::       ..|:.::::|.: ..|.|:|..:|:|..:..||.:.. :.:..|.:|:.
  Rat   243 HRFLKQNIVQFIQGAEYEGSHLDDQDDL-AFPGHVAAFKGDLEMLKKLIDDGVINLNERDENGST 306

  Fly   927 ALHIA-----VRCAQFFIVRELLTESRVNAEATNLKGRNPLHELCRVVEDSTAGLICELFLESMP 986
            .:|.|     :.|.|:      |.|...::..||..|..|..     |....|.|.....||.:.
  Rat   307 PMHKAAGQGHIDCLQW------LVEMGADSNITNKAGERPSD-----VAKRFAHLAAVKLLEGLQ 360

  Fly   987 KYPINIPDMDGNTPLLLSFMRGQSPLCKILVKAGACLGTENKDGINIFNFKLATDQL-LHNLLDQ 1050
            ||.|:  |::|:...:..|:|           .|....|:.||.:::.....|..:: .|..:.:
  Rat   361 KYEID--DIEGDKNHISFFIR-----------HGVEGSTDAKDDLSLSESDKANARMRAHKKIVE 412

  Fly  1051 LPQESPWAESDY 1062
            |.|....|||::
  Rat   413 LRQLLEIAESNF 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125
ANK repeat 468..501 CDD:293786
Ank_2 473..572 CDD:289560
ANK repeat 503..539 CDD:293786
ANK 536..660 CDD:238125
ANK repeat 541..572 CDD:293786
ANK repeat 574..637 CDD:293786
Ank_2 579..670 CDD:289560
ANK repeat 639..670 CDD:293786
Ank_2 644..752 CDD:289560 28/136 (21%)
ANK repeat 672..721 CDD:293786 13/72 (18%)
ANK 721..843 CDD:238125 35/154 (23%)
ANK repeat 723..752 CDD:293786 15/61 (25%)
ANKYR 752..977 CDD:223738 54/242 (22%)
ANK repeat 754..786 CDD:293786 5/31 (16%)
ANK 820..944 CDD:238125 33/141 (23%)
ANK repeat 822..855 CDD:293786 12/37 (32%)
ANK repeat 857..888 CDD:293786 6/37 (16%)
ANK 885..1017 CDD:238125 32/137 (23%)
ANK repeat 890..921 CDD:293786 7/31 (23%)
ANK repeat 923..955 CDD:293786 7/36 (19%)
ANK repeat 996..1021 CDD:293786 3/24 (13%)
FYVE_ANFY1 1054..1116 CDD:277267 3/9 (33%)
Ankrd42XP_017444434.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115202at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.