DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG41099 and Mos

DIOPT Version :9

Sequence 1:	NP_001015359.1	Gene:	CG41099 / 3355072	FlyBaseID:	FBgn0039955	Length:	1124	Species:	Drosophila melanogaster
Sequence 2:	NP_064487.3	Gene:	Mos / 24559	RGDID:	3103	Length:	342	Species:	Rattus norvegicus

Alignment Length:	130	Identity:	32/130 - (24%)
Similarity:	49/130 - (37%)	Gaps:	25/130 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   992 IPDMDGNTPL---LLSFMRGQSPL-CKILVKAGACLGTENKDGINIFN--FKLATDQLLHNLLDQ 1050
            |.:..||..|   :....|...|| |:..:..|.||    |..::|.|  ..|.:..:||  ||.
  Rat   140 IMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCL----KYSLDIVNGLLFLHSQSILH--LDL 198

  Fly  1051 LPQESPWAESDYCQ----HCTNRF-TITMRKHHCRHCG--------RVLCSKCSCNDVPILKFGI 1102
            .|.....:|.|.|:    .|:.:. .:..|:....|.|        .:|..:.:.....|..|||
  Rat   199 KPANILISEKDVCKISDFGCSQKLQDLRCRQASLHHIGGTYTHQAPELLKGEIATPKADIYSFGI 263

Fly 1103 1102
Rat 264 263

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG41099	NP_001015359.1	BTB	67..164	CDD:279045
		BTB	75..166	CDD:197585
		ANK	252..385	CDD:238125
		ANK repeat	291..322	CDD:293786
		ANK repeat	325..362	CDD:293786
		Ank_2	330..431	CDD:289560
		ANK	463..595	CDD:238125
		ANK repeat	468..501	CDD:293786
		Ank_2	473..572	CDD:289560
		ANK repeat	503..539	CDD:293786
		ANK	536..660	CDD:238125
		ANK repeat	541..572	CDD:293786
		ANK repeat	574..637	CDD:293786
		Ank_2	579..670	CDD:289560
		ANK repeat	639..670	CDD:293786
		Ank_2	644..752	CDD:289560
		ANK repeat	672..721	CDD:293786
		ANK	721..843	CDD:238125
		ANK repeat	723..752	CDD:293786
		ANKYR	752..977	CDD:223738
		ANK repeat	754..786	CDD:293786
		ANK	820..944	CDD:238125
		ANK repeat	822..855	CDD:293786
		ANK repeat	857..888	CDD:293786
		ANK	885..1017	CDD:238125	8/28 (29%)
		ANK repeat	890..921	CDD:293786
		ANK repeat	923..955	CDD:293786
		ANK repeat	996..1021	CDD:293786	7/28 (25%)
		FYVE_ANFY1	1054..1116	CDD:277267	12/62 (19%)
Mos	NP_064487.3	STKc_Mos	58..329	CDD:270881	32/130 (25%)
Mos	NP_064487.3	S_TKc	64..331	CDD:214567	32/130 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0192
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900